(data stored in ACNUC7421 zone)

EMBL: CP000088.PE268

CP000088.PE268       Location/Qualifiers
FT   CDS_pept        complement(300444..301760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54308"
FT                   /db_xref="GOA:Q47TA9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54308.1"
FT                   /translation="MTDEPPHRSPAGTTAAVLLTVAAVMVTGVVTLATVRSHTPSPLER
FT                   TDADVVADALPRLEFVREALHEGAGTAMQELFPEGYFFTHALYGLTWLSVAQRDPDLQD
FT                   RALREARWSLKRLYSPEGTGPFSSVAVPAYGVFHAGWSAWLRGQIVAVAGGPEQAPEEM
FT                   AALDAAAEEIAEAFEASLAHGTPYLTSYPGQAWPVDNVVAMAALRLRDHLAGEDRYAAL
FT                   FRLWMTEVRARLDPATGLIPHRVDPVTGHPVEGARGTSQTLLLRFLFEIDPEWAAADYT
FT                   VFRELFASEHAMLPGVREYPRGNRSPGDVDSGPLIFGLSASASTVALAGSILAQDTATA
FT                   DALTGFAEATGMAVEWRGKRRYLGGVLPVGDAFLMWALTTVPTVPDRIPAAPTTTVSPW
FT                   WRVPWYALTLLPIAALWWIVLVRWRSLRPPRPVPERSDP"
     gtgaccgacg aacctcccca ccgttcccct gccggcacga cagcggcagt gctcctcacc        60
     gtggcagccg tcatggtcac cggggtagtg actttggcga ctgtccgctc ccacaccccc       120
     tccccgctgg agcgcaccga cgccgacgtg gtcgccgacg cgctgccccg cctcgagttc       180
     gtccgggaag cactgcacga gggagcgggc acggcgatgc aggagctgtt ccccgagggg       240
     tacttcttca cgcacgcgct gtacgggctg acgtggctgt ccgtggccca gcgcgacccc       300
     gacctgcagg accgagcgtt acgggaggcc cgctggtccc tcaaacggct ctactccccc       360
     gaaggcacgg gaccgttctc ctcggttgca gtccccgcct acggtgtatt ccacgcgggc       420
     tggagcgcct ggctgcgcgg acagatcgtg gctgtcgcgg gcggaccaga gcaggctccc       480
     gaggagatgg ccgcgctcga cgccgccgct gaagagatcg ccgaagcgtt cgaagcctcc       540
     ctcgcccacg gcacccccta cctcacctcc tatcccggcc aagcgtggcc ggtggacaac       600
     gtcgtcgcca tggcggccct gcgactccgc gaccacctgg caggcgagga ccgctacgcc       660
     gcactgttcc gcctgtggat gaccgaggtg cgcgcccggc tcgaccctgc caccgggctc       720
     atcccgcacc gggtcgaccc cgtgaccgga cacccggtcg aaggggcgcg cggcacttcc       780
     cagacactgc tgctgcggtt cctgttcgaa atcgacccag agtgggcggc cgccgactac       840
     accgtgttcc gggagctctt cgcctccgag cacgcgatgc tgccgggggt gcgcgaatat       900
     ccgcggggca accgctcccc cggggacgtc gactccggtc cgctgatctt cggcctgtcc       960
     gcttccgcga gcactgttgc tctcgctgga agcatcctcg cgcaggacac cgccacggcc      1020
     gacgccctca ccgggttcgc cgaggccacc ggcatggccg tggaatggcg gggcaaacgc      1080
     cgctacctcg gcggggtgct cccggtcggt gacgcgttcc tcatgtgggc actgaccacg      1140
     gtcccgaccg tgccggaccg gatcccggcc gctcccacca ccaccgtctc cccgtggtgg      1200
     cgggtgccgt ggtatgcgct gaccctgctc cccatcgcag ccctgtggtg gatcgtcctc      1260
     gtccgctggc gctcccttcg cccgccccgt cccgtaccgg agcgaagtga cccgtga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page