(data stored in ACNUC7421 zone)

EMBL: CP000088.PE278

CP000088.PE278       Location/Qualifiers
FT   CDS_pept        312892..314046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0280"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54318"
FT                   /db_xref="GOA:Q47T99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47T99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54318.1"
FT                   /translation="MATTTEKTPAAPGVVATESNQAVPAISLEKVSKTYRSGQVTTTAV
FT                   ESIDLEIRQGEFFSLLGPSGCGKTTTMRMIAGFEEPTSGVVRLSGKDVTGVPPNRRDVN
FT                   MVFQSYALFPHMTVAENVAFGLKRKKVPAAEIRTRVAEMLELVELGDRAKYKPRQLSGG
FT                   QQQRVALARALVNRPSALLLDEPLGALDLKLRQAMQLELKRIQREVGITFVYVTHDQSE
FT                   ALTMSDRIAVMNKGRIEQLGTPAQIYETPATRFVAGFIGTSNILTGTAQRVSDTLVRID
FT                   YGGDQHVLANTPQQMSDLGLVITVRPEKIRLGKDVPDANVSRIRGTVREVVYLGATTHY
FT                   TVRTVDDTDIVVFQQNSSDASNLADHGDTVWLSWRPEHSYVLPG"
     atggcgacca cgacggaaaa aacaccggcc gcgcctggcg tagtagcgac agagagcaac        60
     caggcagtcc ccgccatcag tctggaaaaa gtcagcaaga cctaccgatc cgggcaggtc       120
     accaccaccg cggtcgaatc catcgacttg gagatccgtc aaggggagtt cttctccctg       180
     ctcgggcctt ccggttgcgg caagaccacc accatgcgga tgatcgccgg cttcgaggag       240
     cccacttcag gagtcgtgcg cctgtccggt aaagacgtca ccggggttcc cccgaaccgc       300
     cgcgacgtca acatggtctt ccaaagctac gccctgttcc cgcacatgac cgtcgcggag       360
     aacgtggcct tcggactgaa acgcaagaaa gtccccgcgg ccgagatccg cactcgggtc       420
     gctgaaatgc tcgaactcgt cgagttgggg gaccgggcca agtacaagcc caggcagctt       480
     tctgggggtc agcagcagcg tgtcgcactg gcccgcgccc tcgtcaaccg gccgagcgca       540
     ctcctgctcg acgaacctct cggtgctctt gacctgaaac tgcgccaggc catgcagttg       600
     gagctcaaac gcatccaacg cgaggtcggc atcaccttcg tctacgtcac tcacgaccag       660
     agtgaagcgt tgaccatgtc cgaccgcatc gccgtcatga acaagggccg gatcgaacag       720
     ctcggcacgc cagcgcagat ctacgagacc cccgcgaccc ggttcgtggc cgggttcatc       780
     ggcacctcca acatcctcac cgggaccgcg cagcgggtct ctgacactct cgtccgcatt       840
     gactacggcg gcgaccagca cgtcctcgcg aacaccccgc aacaaatgtc ggatttgggg       900
     ctcgtaatta ccgttcgtcc tgaaaagatc cgacttggga aagatgtgcc ggatgccaat       960
     gtaagccgca ttcgcggtac ggtgcgtgag gttgtctatt tgggagcaac gacgcactac      1020
     actgtgcgaa cggttgacga caccgacatc gtggtgtttc aacagaactc ctccgacgcc      1080
     agcaacctcg cagatcacgg agacaccgtg tggctgtcct ggcgtcccga gcactcttac      1140
     gtgcttccag gctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page