(data stored in ACNUC7421 zone)

EMBL: CP000088.PE28

CP000088.PE28        Location/Qualifiers
FT   CDS_pept        complement(34593..34904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54068"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54068.1"
FT                   /translation="MVFKRVGNGRPYPDHGLSPSAWYKIAPRQVRLDELVTTKSVLDLK
FT                   YLLSKDSTFFGDLFPHVVRWKGELYLEDGLHRTLRAALQQRETVAARVYDPAWFPELS"
     atggtcttca agcgggtcgg caacggccgt ccttatcctg atcacggcct gtcgccaagc        60
     gcgtggtaca agattgcgcc tagacaggtg cggctggatg agctcgtgac caccaagagt       120
     gttttagatt tgaaatacct cctctccaag gactccacct tcttcgggga tctttttccg       180
     cacgtggtgc ggtggaaagg cgaactctac ttggaggacg gattgcaccg gacgctgcgc       240
     gccgccttgc agcagcggga aacggtggcg gcccgggttt acgacccggc ctggttcccg       300
     gagttgagtt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page