(data stored in ACNUC7421 zone)

EMBL: CP000088.PE287

CP000088.PE287       Location/Qualifiers
FT   CDS_pept        complement(326570..327841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0289"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54327"
FT                   /db_xref="GOA:Q47T90"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54327.1"
FT                   /translation="MPRSPSHWSDIPQADERSMRRLRITRWFVLICVALYAVFILVMAL
FT                   VQVELAFTSPEEVQWGPLSWSGMTLPWYAALLLVLAGAVAVLTVLLVRCRINGRRSCPP
FT                   ALLYWSLGVLLALVSVMDVTVFSVAIVATWWSAAILVIPRRTAVLLSTAVVGFLISYTL
FT                   VLSSQPSVVALAFIILNLPMALLNAAGSFSVVWLWEVAREATLAREARARLAVSEERLR
FT                   FARDMHDLLGHSLSGIAVKSELAARLARSDPERAAAEMAEVQRIAREALREVRAAVSGY
FT                   RAVNLADELASVRSVLLAAGVSATVTGNPADIPAQSQSLIAWLVREGATNVLRHSSAQR
FT                   CDITLSRQDRTWVVEVYNDGVRAGKATRFGNGLTGLSERVASAGGTLTASHTCNGGFLL
FT                   RAVLPVPASVEEPVRETQEKKAVA"
     atgccacgat cgccctccca ctggtccgac atacctcaag ccgacgaacg cagcatgcga        60
     cggctgcgga tcacccgctg gttcgtgctc atctgcgtag ccttgtacgc cgtcttcatc       120
     ctggtgatgg cgctggtcca ggtggagctg gcgttcactt ccccggagga ggtgcagtgg       180
     gggccgctct cctggtccgg gatgacgctg ccctggtatg cggcgctcct cctcgtgctg       240
     gccggggccg tggccgtgct caccgttctt cttgtccgct gccggatcaa cgggcggcgc       300
     tcctgtcccc ctgcgctgct ctactggtcg ctcggagtgc tcctcgccct ggtctcggtc       360
     atggacgtga ccgtgttctc cgttgcgatc gtggccacgt ggtggtcggc agcgatcctc       420
     gtcatcccgc gccgcaccgc agtcctcttg tccacggccg tcgtcggctt cctcatcagc       480
     tacaccctgg tcctgtcctc gcagccgtcc gtggtcgcgc tggcgttcat catcctcaac       540
     cttccgatgg cgctgctcaa cgcggcaggg agcttctcgg tggtgtggct gtgggaagtc       600
     gcccgcgaag ccaccctggc gcgggaggcg cgggcccggc tcgcggtcag tgaggaacgg       660
     ctgcggttcg cccgggacat gcacgacctt ctcggccaca gcctgtccgg tattgcagtg       720
     aaaagcgagc tcgccgcccg gcttgcccgg agcgacccgg agcgcgccgc ggcagaaatg       780
     gccgaagtgc agcggatcgc ccgggaagca ctgcgcgagg tgcgggccgc cgtcagcgga       840
     taccgcgccg tgaacctggc cgacgaactg gcgagcgtgc gctccgtgct gctggctgcg       900
     ggggtctccg ccacggtcac gggcaacccc gcggacatcc cagcgcagtc ccagtccttg       960
     atcgcgtggc ttgtccggga gggggcgacg aacgtgctgc ggcacagcag cgcacagcgc      1020
     tgcgacatca cgctctcccg ccaagaccgc acctgggtgg tggaggtgta caacgacggg      1080
     gtgcgcgccg ggaaagccac caggttcggc aacgggctga ccggcctgtc ggagcgggtg      1140
     gcctccgccg gcggcactct caccgcgagc cacacctgca acggcggctt cctgctgcgc      1200
     gcggtcctgc ccgtccccgc ctccgtcgag gagccggtca gggaaaccca ggagaagaaa      1260
     gctgtcgcat ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page