(data stored in ACNUC7421 zone)

EMBL: CP000088.PE291

CP000088.PE291       Location/Qualifiers
FT   CDS_pept        331295..332044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54331"
FT                   /db_xref="GOA:Q47T86"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54331.1"
FT                   /translation="MWVERLARGIGELAQIVDGARDRVLDQVSQLMVRHVPECSAALVV
FT                   VWRDTHPEERDPSVDFKGRHVVVDYAASHSDLATAFEYQYETGQGPTVQAVRERHTVVV
FT                   ADILRDERWPEYPSMAVQCGDHSSITYPCDLDGEILTLGVHTCRGNRLSPDTMVLPLAM
FT                   LAEHVVTTLRSLGRDADALREAVHMRRAMSARTVIDQAKGILMHARGLTSQQAFEELRK
FT                   VAQRNGMKVTDVAQQLMAEQALSNGRR"
     atgtgggtcg aacgcttggc gcggggcatt ggcgagctgg cccagatcgt ggacggtgcc        60
     cgggaccggg tactggatca ggtcagccag ctcatggtgc ggcacgtgcc cgagtgctcc       120
     gcggcgctcg tggtggtgtg gcgcgacacg caccctgagg agcgcgaccc cagcgtggac       180
     ttcaaggggc gccacgtggt cgtggactat gccgcctccc actccgacct cgccactgct       240
     ttcgagtacc agtacgaaac aggtcagggg ccgaccgtgc aagcggttcg ggaacgtcac       300
     actgtcgtgg tggcggacat tctgagggat gagcggtggc cggagtatcc cagtatggcc       360
     gtccagtgcg gggaccactc ttcgatcact tatccgtgcg atctcgacgg tgagattttg       420
     acgctcggtg tccacacctg ccgggggaac cgcctctccc cggacaccat ggtgctgccg       480
     ctcgccatgc tcgccgagca tgtggtcacc accctgcgca gcctcggccg ggatgccgac       540
     gcgctgcggg aggccgtgca catgcgccgg gcgatgtctg cacgcacggt gatcgaccag       600
     gccaagggga tcctcatgca cgcgcgcggg ctcacctcgc agcaggcgtt cgaggaactg       660
     cgcaaagtgg ctcagcgcaa cgggatgaaa gtcacggacg tcgcccagca gctcatggcg       720
     gaacaagccc tcagtaatgg ccgccggtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page