(data stored in ACNUC7421 zone)

EMBL: CP000088.PE295

CP000088.PE295       Location/Qualifiers
FT   CDS_pept        335442..336206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0297"
FT                   /product="Protein phosphatase 2C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54335"
FT                   /db_xref="GOA:Q47T82"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54335.1"
FT                   /translation="MGVARGAVEVTVLTHRGAVRQANEDAVVMGALTVAGAEMNAPVHC
FT                   WLPLADPVVVAVADGLGGHAAGEIAAEHAVHRMAESSAQLTGPEAVGLLLKHIDDEIKE
FT                   HAGQHVEFSGMGTTVAGVLLTPDANYWFNVGDSRTYRLKGSQLIQLSEDDSPVLPPGED
FT                   GRPVTTNYITQSLGGSGNSTIVPHVGQDTEPGPGAWLMCSDGLSDLVPLEEMERIIAEA
FT                   GDDNIAVYNLWQAAMNASGRDNISILLVRRHS"
     atgggtgtcg ctcgtggggc agtcgaggtt acagtcctca cgcacagagg cgctgtccgc        60
     caggctaatg aggatgccgt ggtcatgggt gcgctcacgg tcgcgggcgc cgaaatgaac       120
     gctccggtgc actgctggct gcccctcgct gatcccgtcg tcgtcgcggt cgccgacggt       180
     ctgggaggcc acgccgccgg tgagatcgcc gcggagcacg cggtccaccg gatggcggag       240
     agtagcgccc agttgaccgg cccggaagcg gtgggtctgc tgctcaaaca catcgacgat       300
     gagatcaagg agcatgccgg gcagcacgtg gagttctcgg ggatgggaac cacggtcgcg       360
     ggggtcctgc tcacgcccga cgcgaactac tggttcaacg ttggggactc ccggacctat       420
     cgcttgaagg gctcccaact gatccagttg tccgaggacg actccccggt gctaccgccg       480
     ggagaggacg gccgtccggt cacgacgaac tacatcaccc agtcgctggg cggcagcggc       540
     aactcgacca tcgtgccgca cgtgggccag gacaccgagc cggggcccgg tgcctggctg       600
     atgtgcagcg acgggctgtc cgacctggtt ccgctggagg agatggagcg catcatcgct       660
     gaagcgggcg atgacaacat cgccgtctac aacttgtggc aggctgcgat gaacgcgtcc       720
     ggtcgggaca acatcagcat cctgctggta cgtcgccact cctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page