(data stored in ACNUC7421 zone)

EMBL: CP000088.PE296

CP000088.PE296       Location/Qualifiers
FT   CDS_pept        complement(336271..336903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0298"
FT                   /product="similar to Cu resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54336"
FT                   /db_xref="GOA:Q47T81"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54336.1"
FT                   /translation="MSAFSASSPGGRIIALVTGLLTALALSLGVAPTAHAHNTLVSSSP
FT                   EDGATLDSLPEKVVLTFNAEVLEGGNGIVVTGPDGTNYASGDVVIDGVEASIDLEPLTQ
FT                   PGEYTVEYRIISADGHPLSDTFTFTVDESAIPEPTESPAAEQPEEEEPTPAPAETEGTE
FT                   SEDSTSTTGVGLSGPLGAILGIVLGIGVIAVIAITIIRLRRRPGSGD"
     atgtcagcct tctccgcctc atcccccggc ggtcgcatca tcgcgctggt gacaggtcta        60
     ctcaccgccc tggctctgtc cctgggggtc gcccccacgg cacacgcgca caacaccctc       120
     gtctcctcgt cccccgagga cggggccacc ctcgactctc tccccgagaa ggtagtgctg       180
     accttcaacg cggaagtgct ggagggaggc aacgggatcg tcgtcaccgg cccggacggc       240
     accaactacg cctctggtga tgtcgtcatc gacggggtgg aagcctccat cgacctggaa       300
     ccgctcaccc agcccggcga atacaccgtc gaataccgga tcatctccgc cgacggccac       360
     ccgctttcgg acaccttcac gttcaccgtg gacgagtccg ctatccccga gcccaccgag       420
     agcccggctg ctgaacaacc tgaagaagag gagcccacgc ctgcccctgc ggaaactgaa       480
     gggacggagt ccgaggacag cacctcgaca accggcgtgg gtctttccgg tccgctcgga       540
     gcgatcctgg gaatcgtcct gggaatcggc gtcatcgcgg tgatcgcaat caccatcatc       600
     cgcctgcgcc gccgtcctgg ctccggagac tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page