(data stored in ACNUC7421 zone)

EMBL: CP000088.PE303

CP000088.PE303       Location/Qualifiers
FT   CDS_pept        342303..342941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0305"
FT                   /product="amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54343"
FT                   /db_xref="GOA:Q47T74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54343.1"
FT                   /translation="MTWDWEFTGRIIPDLLNGLAVTVQATVLGYTLALVLGLAVALVRR
FT                   IPVIGTAVFAVMEFIRCTPLLVQLVFVFSLAPNTLSAFTIGVAVLGVHYAAYTAEVYRS
FT                   GIEAVPAGQWEACRALSLPLHRTWGAVILPQAIRRVIPPLGNYLIAMFKDTPLLFAITV
FT                   GELMYQASQIGGVYFRYLEAMTLVGLFFLLVSVPSAILIRQLERRYAAV"
     atgacctggg actgggagtt caccgggcgg atcatccccg acctgctcaa cggcctcgct        60
     gtcaccgtgc aagccacggt gctgggctac accctggcgc tcgtcctcgg cctcgcggtg       120
     gccctggtac gccgcatccc cgtgatcggg accgcggtgt tcgcggtcat ggagttcatc       180
     cgctgcaccc cgctgctcgt gcaactggtc ttcgtgttct ccctggcccc gaacacgctg       240
     tcggcgttca ccatcggcgt ggcagtgctg ggcgtgcact atgccgccta caccgcggag       300
     gtgtaccggt cgggcatcga agccgtgccc gcaggccagt gggaagcctg ccgggcgttg       360
     agcctgcccc tgcaccgcac gtggggcgcg gtcatcctcc cgcaggcgat ccgccgcgtc       420
     atccctccgc tcggcaacta cctgatcgcc atgttcaaag acacgccgct gctgttcgcg       480
     atcaccgtcg gcgaactgat gtaccaggcg tcgcagatcg gcggcgtgta cttccgctac       540
     ctggaggcca tgaccctcgt gggtctgttc ttcctcctgg tgagcgtgcc ttcagccatc       600
     ctcatccgac aactggagcg acgctatgcc gcagtctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page