(data stored in ACNUC7421 zone)

EMBL: CP000088.PE316

CP000088.PE316       Location/Qualifiers
FT   CDS_pept        complement(356767..358086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0318"
FT                   /product="cobalamin biosynthesis protein CobG, precorrin-3B
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54356"
FT                   /db_xref="GOA:Q47T61"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54356.1"
FT                   /translation="MAAGWFPQAKLDDSSITVARAAPVLHRSSRSPRRDHHSAGQESVC
FT                   NHVPVFCLQPPDRCPGVLRPHFAADGALLRIRIPGGHISRRGIATLSQITAKFGDGNLH
FT                   LTSRGNVQIRGIPVTDDQQIPNELPHIVAASGFLPSSTHDRVRNIVASPLSGIIGGRMD
FT                   VRPLVSALDRALCTDPRLAELPGRFLFGLDDGRGDLAGMPIDLGIYAIDERSAQIRVGT
FT                   FSGPVISSTEIVDIILDLAHRFLDISEGKWNVVQLPKKGRELLNNVEFSNFLRHTKSGD
FT                   RWSVERFRRNILHGIITISTAESAVAGSVPLGVLTPPMQRALLDAAEHSDSTIILTPWR
FT                   GVIVTPVPTDQASNVAALLQEAGLVLDPASPWSRISACIGSPGCARSRGDTRSQAVKLV
FT                   RRLSSPDTSDDGSPYHIAGCERACGAPHTPHTLVLLGSST"
     gtggccgcgg ggtggtttcc ccaagcaaag ctcgacgact cctcgatcac agtggcgagg        60
     gccgcgccgg tcttgcaccg gtcttcccgt tcaccacgac gcgaccacca tagcgcaggg       120
     caagaaagcg tatgcaacca tgttccggtg ttctgtctac agccacctga ccgctgcccc       180
     ggcgtgctgc gtccccattt cgcagccgac ggcgctctgc tgcgtattcg tattcccggg       240
     gggcatatta gccgtcgcgg gatagccacg cttagccaga tcaccgcaaa attcggcgac       300
     ggtaatctcc atttaacttc acgtggaaac gtgcaaatca gagggattcc cgtcacagat       360
     gatcaacaga ttcccaacga attacctcat attgtggcag catccggatt cctgccttca       420
     tctacccatg atcgggtacg caatattgtc gcttctcccc tttccggaat aatcggtggc       480
     agaatggatg ttcgccccct cgtctccgct ctagaccggg cactgtgcac tgatccacga       540
     ctggcagagc tgcccggacg gttccttttc ggtcttgatg acggccgcgg cgatctcgct       600
     ggaatgccta tcgacttagg aatttacgcg atcgacgaac ggtcggcaca aatacgtgtc       660
     ggcacctttt cagggcctgt gatttcatct acagaaatcg ttgatataat ccttgatctc       720
     gctcaccgtt ttctcgatat aagcgaggga aaatggaatg tcgttcagct accaaaaaaa       780
     ggacgagaac tactcaacaa cgtcgagttt tccaattttt tacgccatac aaaaagcggc       840
     gatcgctgga gcgttgaacg gtttcgaaga aacatccttc acggaattat caccatttcc       900
     accgctgaat ccgctgtggc gggttcagtg ccgctaggcg ttctcacccc gcccatgcag       960
     cgggctctct tggatgcagc ggagcacagc gacagcacga tcatcctcac cccgtggcgg      1020
     ggagtgatcg tcacccctgt ccccaccgac caggccagca acgtcgcagc tttgctccag      1080
     gaagccgggc tggtcctcga cccggcatcg ccgtggagcc ggatcagcgc ctgcatcggc      1140
     tcccccggct gtgctcgcag ccgtggcgac acccggtctc aagccgtcaa gctcgtccgc      1200
     cgcctatcct cccccgacac atccgacgac ggatccccct accacatcgc cgggtgcgaa      1260
     cgcgcctgcg gtgccccgca caccccgcac accctcgtcc ttctcgggag cagcacgtga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page