(data stored in ACNUC7421 zone)

EMBL: CP000088.PE32

CP000088.PE32        Location/Qualifiers
FT   CDS_pept        complement(38934..39296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54072"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54072.1"
FT                   /translation="MRQIIRGAAVSGAAACLLAVSSFPALAEEEADWSTDVSIDLPVLD
FT                   DEVSGLNEQPEGEGLEEDTVGAGTVINQCVVEQDALVLGLAPGDPGGLPLLSLGLNVLN
FT                   EYYCIGNTVEVHNHAN"
     atgcgccaga tcatcagggg ggcggcagta agcggggcgg ccgcgtgtct tctcgctgtc        60
     agctccttcc ccgccctcgc cgaagaagaa gcggactggt ctacggacgt gagcatcgac       120
     ctgcccgtcc tggacgacga ggtctccggc ctcaacgagc agcctgaagg cgaagggctg       180
     gaagaggaca ctgtcggggc gggaaccgtc atcaaccagt gcgttgtcga acaggacgct       240
     ctcgtgctag gtctggcccc cggcgacccc ggtggtcttc cgctgctgtc cctaggcttg       300
     aacgtcctca acgagtacta ctgcatcggc aacactgttg aagtccacaa ccacgccaac       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page