(data stored in ACNUC7421 zone)

EMBL: CP000088.PE320

CP000088.PE320       Location/Qualifiers
FT   CDS_pept        complement(363317..363673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54360"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54360.1"
FT                   /translation="MNRPAGKRRNAGEARDARSGAAGHGPAAERGFLPLGSGVFSLFHG
FT                   QQRVVPAILGRMRRERVEYIGGPLDGKIVELGPDEDVTVGAYLTIPGHTQRAVYEPVPG
FT                   DIVYRWHFLGWIDR"
     atgaatagac cggcggggaa gcggcggaac gccggagagg cacgggatgc ccggtcgggt        60
     gctgcgggcc acggccccgc cgcggaacgc ggatttctac cccttggtag cggggtgttt       120
     tcgctatttc acggacagca gcgggttgtt cccgccatcc tgggacgtat gcgacgcgaa       180
     cgtgtggagt acattggcgg cccgctcgac ggcaagatcg tggagctcgg gccagacgag       240
     gacgtcacgg tcggcgccta cctgaccatt ccggggcaca ctcagcgggc ggtctacgag       300
     ccggtgcccg gggacattgt gtaccggtgg catttcctgg ggtggatcga ccgctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page