(data stored in ACNUC7421 zone)

EMBL: CP000088.PE321

CP000088.PE321       Location/Qualifiers
FT   CDS_pept        363814..365922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0323"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54361"
FT                   /db_xref="GOA:Q47T56"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54361.1"
FT                   /translation="MVQKKTAAVAVNAAQMLTRDRDLLPPDRFMNREIGWLRFNQRVLE
FT                   LAEDTTLPLLERALFLSIFSSNLDEFFMVRVAGLKRRLATGVPVSSRQDPREQLREISK
FT                   VTHELMERHAACFHTSVAPALAEAGIRIVRWNDLTTEEKQQMHRFFRRTIYPVLTPLAV
FT                   DPAHPFPYISGRSLNLAVRVCDPHTGRQTFARIKVPPALPRFTELGGQRFVPVEDVISA
FT                   HLPQLFEGMEILEHHAFRVTRNADLEVDEDETDDLVKSLERELLRRRFGPLVRLEVEET
FT                   ISDEILTLLREELGADEEETYRVPGPLDLSGLAQLHELDRPELKYPPMVPVEPRVLAHN
FT                   DFFEVLRRSELLVHHPYESFATTTQRFIELAASDPKVRAIKQTLYRTSGDSPIMEALIE
FT                   AARSGKEVIVLVEIKARFDEQNNIRWARKLEMAGCHVVYGVVGLKTHCKLALVVREEDD
FT                   GSLRRYCHIGTGNYNPRTARIYEDFGLFSADPEVGEDLSDLFNHLTGFSRKKHYRRLLV
FT                   APHALREALLRQIQHEIANHEQGLPARIRIKTNSLVDEEIVDALYLASRAGVPIDLWVR
FT                   GSCVLRPGVPGLSETIRVRSILGRFLEHSRIFVFANGGEPQVWIGSADLMPRNLDRRVE
FT                   VLVRIVDPGQRSRLMTLMDLAMADSTSSWHLNPDGSWTRFTHDEEGNPLVDVQSTLRGD
FT                   RYLRVVDD"
     atggtgcaga agaagacagc ggccgtagcg gtgaacgcag cgcagatgct cacccgagac        60
     agagacctcc tgccccccga ccgcttcatg aaccgggaga tcggctggct ccgcttcaac       120
     cagcgggtcc tggaactcgc ggaagacacc acgctgccgc tgctggaacg ggccctgttc       180
     ctgtccatct tctccagcaa cctcgacgag ttcttcatgg tgcgggtcgc cggactcaaa       240
     cgccgcctcg ccaccggggt ccccgtctcc tcccggcagg acccccgcga acaactacgg       300
     gagatcagca aagtcaccca cgagctcatg gaacggcacg cggcatgctt ccacacctcg       360
     gtagcgccgg cgctcgccga agccgggatc cgcatcgtgc gctggaacga cctcaccacc       420
     gaagagaagc agcagatgca ccgcttcttc cgccgcacga tctacccggt gctcaccccg       480
     ctcgccgtcg acccggccca cccgttcccc tacatttccg ggcgctccct caacctcgcg       540
     gtccgagtgt gcgacccgca cacgggacgg cagacgttcg cgcgcatcaa agtccccccg       600
     gcgctgccgc gcttcaccga actcggcggc cagcgtttcg tccccgtcga agacgtcatc       660
     tccgcgcacc tgccgcaact gttcgaaggc atggagatcc tggaacacca cgcgttccgg       720
     gtcacccgca acgccgacct agaagtggac gaagacgaaa ccgacgacct cgtcaaatcc       780
     ctggaacggg aactgctgcg ccgccgcttc ggacccctcg tgcgcctgga ggtcgaagag       840
     accatctccg acgagatcct caccctcctc cgcgaagaac tcggcgcgga cgaagaagag       900
     acctaccgcg tgcccggccc gctggacctc tccggcctcg cccaactcca cgaactcgac       960
     cggccggaac tcaaataccc gccgatggtc ccggtcgagc cgcgcgtcct cgcccacaac      1020
     gacttcttcg aagtgctgcg ccgcagcgaa ctcctcgtcc accaccccta cgagtcgttc      1080
     gccaccacca cccagcggtt catcgaactc gcggcctccg acccgaaagt gcgggcgatc      1140
     aaacagaccc tgtaccgcac cagcggcgac tccccgatca tggaggccct catcgaagcc      1200
     gcccgctccg gcaaagaagt catcgtcctc gtggagatca aggcccgctt cgacgagcag      1260
     aacaacattc gctgggcccg caaactggag atggcgggct gccacgtggt ctacggggtg      1320
     gtcgggttga agacccactg caagctcgcc ctcgtcgtcc gggaagaaga cgacggcagc      1380
     ctgcgccgct actgccacat cggtaccggc aactacaatc cgcgcaccgc ccgcatctac      1440
     gaggacttcg gactgttcag cgccgacccg gaagtaggcg aagacctcag cgacctgttc      1500
     aaccacctca ccggcttctc ccgtaaaaag cactaccggc ggctgctcgt ggccccgcac      1560
     gcgctgcggg aagccctgct gcgccagatc cagcacgaga tcgccaacca tgagcaaggg      1620
     ctgccagccc gcatccgcat caaaaccaac tcgctggtcg acgaggagat cgtcgacgcc      1680
     ctctacctcg cgtcccgggc cggggtcccc atcgacctgt gggtgcgggg cagctgcgtc      1740
     ctccgccccg gggtgccagg gctctccgag acgatccggg tgcgcagcat cctcggccgg      1800
     ttcctggagc actcccgcat cttcgtcttc gccaacggcg gagagccaca ggtgtggatc      1860
     ggaagcgccg acctcatgcc gcgcaacctg gaccgcaggg tggaagtgct ggtccgcatc      1920
     gttgatccgg ggcagcgttc ccggctcatg accctcatgg acctggccat ggcggacagc      1980
     acgtcgtcgt ggcacctcaa cccggacggc agttggaccc ggttcaccca cgatgaggaa      2040
     ggaaacccgc tcgtggacgt acagagcacc ctgcgcggcg accgctacct gagggtggtc      2100
     gatgactga                                                              2109
//

If you have problems or comments...

PBIL Back to PBIL home page