(data stored in ACNUC7421 zone)

EMBL: CP000088.PE322

CP000088.PE322       Location/Qualifiers
FT   CDS_pept        365915..366892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0324"
FT                   /product="putative MutT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54362"
FT                   /db_xref="GOA:Q47T55"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54362.1"
FT                   /translation="MTEPPPTPDRHPDAVESAAPGGYLEPVRAAGTVLWRDTGRGREIA
FT                   LVHRPRYNDWTLPKGKLDEGEHVLVAAVRETVEETGVTPRLGRRLATQRYWKSGWPKQV
FT                   DWWAATPAPGTTAQFTPTAEVDAVEWLPAAEARARLTYPSDVRVLDDFLHGPAQTVPLV
FT                   LLRHASAGNKNEWHDYDLLRPLDEAGRAHARAVADILAVFGPLRVVSSTAARCLETVVP
FT                   YAAAHGVEIRTEHTFTVGVLRSGAQAYDPQAARQTMRALVEERQPTLVCTHGELVADLM
FT                   AEAAAQTGAPARSRWALRKGAFWVVHRDAKDGSLVAVEHHGLPG"
     atgactgagc cgccgcccac tcctgaccgg catccggacg ccgtggaatc cgccgcgccc        60
     ggcggctacc tggaacctgt ccgggccgcg gggaccgtcc tgtggcggga caccggccgc       120
     ggccgcgaaa tagccctggt ccaccggccc cgctacaacg actggaccct gccgaaaggg       180
     aaactggacg aaggggagca cgtcctcgtc gccgcggtgc gggaaaccgt ggaagagacc       240
     ggggtcaccc cgaggctggg ccgtcgcctg gccacgcagc gctactggaa gtccggttgg       300
     cccaaacagg tcgactggtg ggccgccacc cccgcaccgg gcacgaccgc ccagttcacc       360
     cccaccgcgg aggtggacgc ggtcgaatgg ctgcccgcgg cagaagcccg cgcccggctc       420
     acctatccca gcgacgtccg cgtccttgac gacttcctgc acggacccgc acagaccgtg       480
     ccgctggtgc tgctgcggca cgcctcggcc gggaacaaaa acgaatggca cgattacgac       540
     ctgcttcggc cgttggacga ggcagggcgg gcccacgcgc gcgcagtagc cgacatcctc       600
     gccgtattcg ggcctttgcg cgtggtctcc tcgacggccg cgcgctgtct cgagaccgtg       660
     gtgccgtacg cggccgccca cggggtagag atccgcacgg agcacacgtt caccgtgggg       720
     gtgctccgct ccggggccca ggcttacgac ccgcaggccg cccgccagac gatgcgggcc       780
     ctggtcgagg agcggcagcc cactctggtg tgcacgcacg gcgaactcgt ggcggatctc       840
     atggcggaag ccgccgccca gaccggtgcc cccgcccggt cgcggtgggc gctgcggaaa       900
     ggcgcgttct gggtggtgca ccgggacgcc aaagacggtt ctcttgttgc ggtagagcac       960
     cacggcctgc ccggctag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page