(data stored in ACNUC7421 zone)

EMBL: CP000088.PE325

CP000088.PE325       Location/Qualifiers
FT   CDS_pept        complement(368477..369298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0327"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54365"
FT                   /db_xref="GOA:Q47T52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54365.1"
FT                   /translation="MPASSSPKPAGAPLTGRVPRLLLVPALLGFGFLVLPLFGLLARTP
FT                   WSTLGAQLFSTGVRDALLLSLATASAATVVSLVLGVPLAWLLARTEFPGRSLVRALVTV
FT                   PLVLPPVVGGVALLMVWGRNGLLGRYVAEWTGYGLPFTPAGVVAAQVFVAMPFLVMSVE
FT                   GALRGMDRRYEEAAATLGANRWTVFRRVTLPMVAPGILAGAVLCWSRALGEFGATIMFA
FT                   GNYPGRTQTMPLAVYLEMQRSPEAAVVLSLVLLAVSVLILVVLRDHWLGAR"
     atgccggctt cctcctcccc taagcctgcc ggtgccccgc tgacaggccg ggttccccga        60
     ctgctgctgg tgcccgcgct gctcggcttc ggcttcctgg tgctgccgct gttcggcctg       120
     cttgcccgca ccccgtggtc cacgctgggc gcccaactgt tctccacggg ggtgcgcgac       180
     gcgctcctgc tctccctggc cacagcgagc gcagccaccg tggtctccct cgtgctgggg       240
     gtgccgttgg cctggctgtt ggcccgcacc gagtttccgg gacgcagcct cgtccgggcc       300
     ctggtcaccg tgccgctggt gctgcctccg gtcgtgggcg gggtggcgct gctcatggtg       360
     tgggggcgca acgggctgct cggccgctac gtggccgagt ggaccggcta cgggctgccg       420
     ttcacccccg ccggggtagt ggccgcgcaa gtgttcgtgg ccatgccgtt cctggtgatg       480
     agcgtggaag gcgcgctgcg cggcatggac cggcgctacg aggaggctgc ggccacgcta       540
     ggggcgaacc ggtggaccgt gttccgccgg gtgacgctgc ccatggtggc gccggggatt       600
     ctcgccggcg cggtcctgtg ctggtcgcgg gcgctcggcg aattcggggc gaccatcatg       660
     ttcgcgggaa actaccccgg ccgcacccag acgatgccgc ttgcggtgta cttggagatg       720
     cagcgcagtc cggaggcggc ggtcgtgctc agcctggtgc tgctcgccgt ctccgttctc       780
     atcctcgtcg tgctgcggga ccactggctg ggggcacggt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page