(data stored in ACNUC7421 zone)

EMBL: CP000088.PE326

CP000088.PE326       Location/Qualifiers
FT   CDS_pept        complement(369276..370043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0328"
FT                   /product="molybdenum ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54366"
FT                   /db_xref="GOA:Q47T51"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54366.1"
FT                   /translation="MRFARCVVAVCAVLVGSACTPVADGSASGPPERTLTVFAAASLTD
FT                   VFRTWGAQFAEQHPGTTVEFAFAGSSALAEQLAQGAPADVFASADQATMDRVVADVGVA
FT                   DEPVVFARNTLQIAVPPENPAGIGSLDDLAADGTTVALCAEHVPCGAASRAVLDAAGVA
FT                   VDPVTWEEDVRAALTRVRLGEVDAALVYRSDVVAAGGDVHGIDIPEAAAAVNDYPIAVL
FT                   ADAAEPELAQAWTAFVTSPDNAKVLDDAGFLLP"
     gtgaggttcg cccgatgtgt cgttgcggtg tgcgctgtgc tggtcggaag cgcgtgcacc        60
     cccgtcgccg acggctccgc ctcgggcccc cccgaacgga cgcttaccgt gttcgccgcg       120
     gcctccctca ccgacgtctt ccggacgtgg ggcgcccagt ttgcggagca gcatcccggc       180
     accaccgtgg agttcgcttt tgcgggcagc tccgcgctcg ccgagcagct cgcgcagggc       240
     gcgcccgccg acgtgttcgc ctccgccgac caggccacca tggaccgggt cgtcgctgac       300
     gtcggcgtcg ccgacgaacc ggtggtgttc gcgcgcaaca cgctgcagat cgcggtccca       360
     ccggagaacc ctgccggtat cggctcgctg gacgacctcg ccgcggacgg gacaacggtg       420
     gcgctctgcg ccgagcacgt gccgtgcggt gcggcatccc gcgcggtcct ggacgccgcc       480
     ggagtggcag tggacccggt gacgtgggag gaggatgtgc gggccgcgct cacccgggtc       540
     cggttgggcg aagtggacgc cgccctcgtg taccgctccg acgtggtcgc cgccggaggc       600
     gacgtgcacg gcatcgacat tccggaagcg gcggccgcag tcaacgacta tccgatcgcg       660
     gtcctcgccg acgcggccga accggaactc gcccaagcgt ggacggcttt cgtgacctcc       720
     ccggacaacg cgaaagtgct ggacgatgcc ggcttcctcc tcccctaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page