(data stored in ACNUC7421 zone)

EMBL: CP000088.PE332

CP000088.PE332       Location/Qualifiers
FT   CDS_pept        complement(374861..377200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54372"
FT                   /db_xref="GOA:Q47T45"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54372.1"
FT                   /translation="MAVGRWLAHVLTTLAVLIILVSAAPPPPGTAAAPHTAPRRGPVVL
FT                   VGVPGLRWDEITPQTTPHLWELARRSAIGNLSIRTVTSRTCPVDGWLTVAAGQRAASER
FT                   QTYSICELPRLPEIDGEGAVIPDYSDHVTYNAASRFGARVGLLGDTVRSYGGTTLAVGP
FT                   GAALAAAGSDGRVDRYLGGTSGLTRESWDGVTLGVIDLKDLADLYLDPPAPEPVGDELV
FT                   DGTGTVDGVPRDLQVPLRLPGDTDPFDDEEEVEPEPDLTETSELQERHERLAAIDRDLA
FT                   TIQATLPPDSTLLVAGISVEAGASRLNTALLHGPGPDGTVFTGGYLVSESTRRPGLVAL
FT                   TDITTTLLYTLDFPPQQGMVGRAWRQTPRPAEFDTAVDQLRKFATAAEVVESLVPGFFS
FT                   GLVATQLLLYVCAAYALKRYGGRDLAKRRLVLSATRVVALAGAAFPVSSYLVNLVPWWS
FT                   APFPQAALLGGVLLADAAVVAVALAGPWRRDILAPTTIVAAITTVVLFADLCTGSHLQM
FT                   NSPTGYTPIVAGRFYGLGNIAFATFATGVLMTAAGIAHHLLGHGRRTWAVAVSLVLGTA
FT                   ALFAIGWPGLGTDFGGVLALVPGLAVTMLMIAGLRVTVGRIAVIGVAAVATIGLLSFLD
FT                   YLRPPNERSHFGLFAGQVLDGTAWPVVSRKIDAMLGSLGNWQLTLLAAGALLFLFVVLN
FT                   NPLNWRVGVLSRVYEYAPTLRAGLTGSLVTGLAGFAFNDSGIAIPALALTVAVPLTLAS
FT                   CVWVLQQTVPLSQPPTVSVCGRTATV"
     gtggctgtag gcaggtggct cgcccatgtg ctgaccacgc tggctgtcct gatcatcttg        60
     gtctcggcgg cgcccccgcc tccggggacc gccgctgcgc cgcacaccgc accccgccgc       120
     gggccggtcg tcctcgtcgg ggttcccggc ctccgctggg acgagatcac cccgcagacc       180
     actccccacc tgtgggagct ggcgcgccgc agcgcgatcg gcaacctgtc catccgcacc       240
     gtcacctcac gcacctgccc cgtcgacggc tggctgaccg tggccgcggg acagcgcgcc       300
     gcaagcgaac ggcagaccta ctccatctgc gaactgccgc gcctccccga gatcgacggg       360
     gaaggcgcgg tcatcccgga ctactccgac cacgtcacct acaacgccgc ttcccgcttc       420
     ggcgcgcggg taggactgct cggcgacacg gtgcgctcct acggcgggac cactctcgcc       480
     gtcgggccgg gcgctgccct ggccgccgca ggcagcgacg gacgggtcga ccgctacctg       540
     ggcggcacct ccgggctgac ccgcgaatcg tgggacgggg tcaccctcgg cgtgatcgac       600
     ctgaaagacc tcgccgacct gtacctcgac ccgcccgccc cggaaccggt cggcgacgag       660
     cttgtcgacg gcaccggcac cgtggacggg gtcccccgcg acctccaagt ccccctgcgg       720
     ctccccggag acaccgaccc gttcgacgac gaggaagagg tcgaaccgga accggacctc       780
     accgaaacca gcgaactcca ggagcggcac gaacggctcg ccgcgatcga ccgggacctg       840
     gccaccatcc aggccacgct gccccccgac tcgaccctgc tcgtcgccgg gatctccgtg       900
     gaagctggcg cgtcccgcct caacaccgcc ctgctgcacg ggcccggccc tgacggcacc       960
     gtcttcaccg gcggctacct cgtctccgag tccacgcggc gccccggact ggtggcgttg      1020
     accgacatca ccaccaccct gctgtacacc ctggacttcc cgccgcagca gggcatggtg      1080
     gggcgggcgt ggcggcagac gccccggccc gccgagttcg acacggcagt cgaccagctc      1140
     cggaaattcg ctaccgcggc cgaagtcgtg gaatcgctgg ttcccggctt cttcagcggg      1200
     ctggtggcca cccagctcct cctctacgtg tgcgccgcgt acgccctgaa acgctacggc      1260
     gggcgcgacc tcgcgaaacg gcgcctcgtc ctgtccgcga cccgagtggt ggcactcgcc      1320
     ggcgctgctt tcccggtctc cagctacctg gtcaacctgg tgccgtggtg gtcggcgccc      1380
     ttcccccagg cggccctgct cggcggggtg ctgctcgccg acgccgcagt cgtggcggtg      1440
     gcgctggccg ggccgtggcg gcgggacatc ctggccccta ccacgatcgt cgcggcgatc      1500
     accaccgtgg tcctcttcgc cgacctgtgc accggatccc acctgcagat gaactccccc      1560
     accgggtaca ccccgatcgt ggcgggccgg ttctacgggc tcggcaatat cgcgttcgcc      1620
     actttcgcca ccggcgtgct gatgaccgcc gcggggatcg cccaccacct cctcggccac      1680
     ggccgtcgca cctgggccgt cgccgtgtcc ctcgtcttgg ggacggcagc gctgttcgcc      1740
     atcggctggc cggggctggg caccgacttc ggcggggtgc tggcactcgt ccccgggctc      1800
     gcggtgacca tgctcatgat cgccgggctg cgggtcaccg tgggccggat cgcggtgatc      1860
     ggcgttgccg cggtagccac gatcggcctc ctgtcgttcc tggattatct ccggccaccg      1920
     aacgaacgca gccatttcgg tttgttcgcg ggacaggtcc ttgacggcac cgcatggccg      1980
     gtcgtatccc gcaaaatcga tgcaatgctg ggttctttgg gcaactggca gctcaccctc      2040
     ctggccgcgg gggctttgct gttcctcttt gtcgtattga acaatccgct gaactggcgg      2100
     gtaggggtgc tctcgcgggt ctacgaatac gcgccgacat tgcgggccgg actcaccgga      2160
     tcgctggtca ccgggcttgc agggtttgca ttcaacgact caggaatcgc tattccggcg      2220
     ctcgcgctga ccgttgcggt ccccctcacc ctggcgtcct gcgtgtgggt actgcaacag      2280
     accgtgccgc tttcccaacc ccccacggtt tcggtatgtg gtcgaaccgc aactgtgtga      2340
//

If you have problems or comments...

PBIL Back to PBIL home page