(data stored in ACNUC7421 zone)

EMBL: CP000088.PE335

CP000088.PE335       Location/Qualifiers
FT   CDS_pept        complement(378730..379770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0337"
FT                   /product="ABC-type enterobactin transport system inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54375"
FT                   /db_xref="GOA:Q47T42"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54375.1"
FT                   /translation="MTAIPLRSLRVGPVALRLRPRVLVSCLALAVLVLAALTACLIVGD
FT                   YSIPLRRIPAALFGSGERLDVFFVRDVRLPRALTAALVGAALGTAGAVFQSLSRNPLGS
FT                   PDIIGFTAGASTGAVLTILVVGGGMLSTALGAMLGGVGTAVLVYLLALRRGVQGYRLIL
FT                   VGIGISAMLGAVTHYLITRAELTDALSAQVWLVGTLNSREWPHVAAVGIGCAVLIPFLL
FT                   RLGAQLRLMEMGEDTARALGVATQRTQTLALLAASALTGIAIAVSGPIAFVALAAPQLA
FT                   RRLTRADGTTLVASALMGAALLLCSDLVALRLLAPVQLPVGVVTTVVGGTYLVWLLYAE
FT                   WRSGRA"
     gtgaccgcga tccccctccg ctcgctccgt gtggggccgg tagcgctccg cctccgcccg        60
     cgcgtactcg tctcctgcct ggctctggct gtcctcgtcc tcgcagcgtt gacggcctgc       120
     ctcatcgtcg gcgactactc gattccgctg cgccgcatcc ccgccgcgct gttcggctcc       180
     ggggagcggc tcgacgtgtt cttcgtgcgc gacgtgcggc tgccgcgcgc gctcaccgcg       240
     gccctggtgg gcgcggccct aggcacggca ggcgccgtgt tccaaagcct gtcgcgcaac       300
     ccgctgggca gtccggacat catcgggttc accgcgggag cctccaccgg ggcggtgctc       360
     accatcctgg tggtcggcgg cggcatgctg tccactgcgc tgggggcgat gctcggcgga       420
     gtgggtacgg ccgtgctcgt ctacctgctc gccctccgcc gcggcgtgca gggctaccgc       480
     ctcatcctgg tgggcatcgg gatcagcgcc atgctcggtg cggtgaccca ctacctcatc       540
     acccgcgcgg aactcaccga tgcgctgtcc gcccaggtgt ggctggtcgg taccctcaac       600
     tcgcgcgagt ggccgcacgt agccgcggtg gggatcggct gcgccgtgct gatcccgttc       660
     ctgctgcggc taggcgccca gttgcggctc atggaaatgg gggaagacac cgcgcgggcc       720
     ttgggcgtgg ccacgcagcg cacccagaca ctggcgctgc tcgcggcgag cgcgctcacc       780
     gggatcgcta tcgcggtctc cggcccgatc gctttcgtcg ctttggctgc ccctcagctc       840
     gcccgccggc tgacccgcgc cgacgggacg actctcgtgg cctctgcgct catgggagca       900
     gcactcctgc tctgctcgga cctggtggcg ctgcggctgc tggcaccggt ccagcttcct       960
     gtgggcgtgg tcaccacggt tgttggcgga acctacctgg tgtggctgct gtacgcggag      1020
     tggcggagcg gccgtgcctg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page