(data stored in ACNUC7421 zone)

EMBL: CP000088.PE347

CP000088.PE347       Location/Qualifiers
FT   CDS_pept        complement(391372..392184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0349"
FT                   /product="similar to Multisubunit Na+/H+ antiporter MnhC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54387"
FT                   /db_xref="GOA:Q47T30"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54387.1"
FT                   /translation="MNDTPTLLLVIVIGVLVTAGVTLLLERSLTRILLGVVLLGNGVNL
FT                   LILSAGGAAGGPPLLSLTPEGEMADPLPQAMILTAIVITLGVTAFLLAMAYRSWQLQGN
FT                   DEVQDDAEDRRIATGGERRRLRQYIRAQKRALRQAIRAQRMELEAQIEAQDELEEAERA
FT                   ILREQIAQARRDLDERLEAADDKDRERIIFQADHAQAAALDEAKRRVREARKELAEHRR
FT                   ADREYERRLRRELRQRIRAQKRQLRASIRAERERLARAEDSDMQGVDY"
     gtgaacgaca cccctaccct cctgctcgtc atcgtgatcg gtgtcctcgt gactgccggg        60
     gtgacgctgc tgctggaacg gagcctcacc cgcatcctgc tgggcgtggt cctcctcggc       120
     aacggcgtca acctgctcat cctgtccgca gggggcgccg cggggggacc accgctcctc       180
     agcctcaccc cggaagggga gatggctgac ccgctccccc aggcgatgat cctcactgcg       240
     atcgtcatca ccctgggcgt gaccgcgttc ctgctggcca tggcctaccg gagctggcag       300
     ctgcagggca acgacgaagt ccaggacgac gcggaagacc ggcgtatcgc caccggcggg       360
     gagcggcggc gcctgcgcca gtacatccgc gcgcagaaac gggcgctgcg ccaggcgatc       420
     cgcgcccagc ggatggaact ggaagcgcag atcgaagcgc aggacgaact ggaagaagcc       480
     gagcgggcga tcctccgcga acagatcgcc caggcccgcc gcgacctgga cgaacgcttg       540
     gaagccgcgg acgacaaaga ccgggagcgg atcatcttcc aagccgacca cgcgcaagcg       600
     gccgcgctgg atgaggccaa acggcgggtg cgggaagccc gcaaggagct cgctgagcac       660
     cggcgtgccg accgggagta cgaacgccgc ctgcggcggg agctgcgcca gcgcatccgc       720
     gcccagaaac ggcagctgcg tgcgagcatc cgcgcagaac gcgaacgcct ggcccgagcc       780
     gaagacagcg acatgcaggg ggtggactac tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page