(data stored in ACNUC7421 zone)

EMBL: CP000088.PE36

CP000088.PE36        Location/Qualifiers
FT   CDS_pept        complement(41202..41438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54076"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54076.1"
FT                   /translation="MRRIMKLAAVSTLAAGLLGAGASSALAGDYTEITATETAQCISAQ
FT                   EATGAGLLLGLGLNLNLLNSSACAGSVNVNDNN"
     atgcggcgaa tcatgaagct ggctgccgtg agcacgctgg ccgcgggtct gctcggcgcc        60
     ggggcctcca gcgccctggc cggcgactac accgagatca ccgccaccga gaccgcgcag       120
     tgcatctcgg ctcaggaggc caccggtgcg ggtctgctcc tcggcctggg cctgaacctg       180
     aacctgctca actcttcggc ctgcgctggc agcgtcaacg tcaacgacaa caactag          237
//

If you have problems or comments...

PBIL Back to PBIL home page