(data stored in ACNUC7421 zone)

EMBL: CP000088.PE360

CP000088.PE360       Location/Qualifiers
FT   CDS_pept        407623..409056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54400"
FT                   /db_xref="GOA:Q47T17"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54400.1"
FT                   /translation="MTNHSTSRSGTDTAVIVIAADDLSAEVFIDGSRHVVHGADAKATR
FT                   RAALDYVTDHAARIGRPVIIEARDVYGVQRLEALPRGVIRSIPQIPPPAPRNSGKQSGS
FT                   RTGVVLALAAAGLAVVVLVVVSVVLVVPRYLPGFGTQAAPSQQAPETPDTIPFEARSAP
FT                   PGFSSEALWRIPVTEGTRPAVSDDGSRVAFIGADGKLAVAGPEGKRLWEADLPIQPAEI
FT                   EGAVRFVKNDDQWEVAIAGTGKLWIWSADGSGPTEYKLPKDGVVTFAGTAPLVTTDKKA
FT                   MVPREGELLEVKVPKGTGGMLVVGDEVLLAAADGPWYWAAPGEEPAKVTAKEPKSADGL
FT                   DRVITASERYVIVRWQSEKEDKVILAAHDARDGSVFAETEITAGELADATWIEGETVAA
FT                   YGPILTDLESGQTQVLPGFTPLNAVAGVVYGELEEGQVAVNAAGEVTPMEPDTARPWGL
FT                   LDGHAVVMADANLYALLPD"
     atgactaatc acagcacctc gcgttccgga acggacaccg cggtcattgt tattgctgcc        60
     gacgacctca gcgcagaggt ctttatcgac ggctcccggc acgttgtcca cggggccgac       120
     gccaaagcga cccggcgggc cgcgctcgac tacgtcaccg accatgccgc ccgcatcggg       180
     cgcccggtga tcatcgaggc acgggacgtc tacggagtcc aacgactgga agcactcccc       240
     cgcggcgtga tccggagcat cccccagatc ccgccacccg cgccgcgcaa cagcggaaaa       300
     cagtcgggga gcaggaccgg cgtggtcctg gccctcgccg cagcaggcct ggcagtggtc       360
     gtcctcgtcg tggtctccgt agtgctcgtg gttccccggt acctccccgg gtttggcact       420
     caggccgcgc cttcgcagca agcccccgaa acgcctgaca ccatcccctt cgaagcacgt       480
     tccgcgcccc ccgggttctc cagcgaagcg ctctggcgga ttcccgtcac cgaaggcacc       540
     cgcccggccg tctccgacga cggcagccgg gtcgctttca tcggggctga cgggaagctc       600
     gcggtcgctg gcccggaagg gaaacggctg tgggaagccg acctgccgat ccaacccgcg       660
     gagatcgaag gggcggtccg cttcgtcaag aacgacgacc agtgggaggt ggcgatcgcg       720
     gggaccggga agctgtggat ctggtctgcc gacggcagcg gccccaccga gtacaagctc       780
     cccaaggacg gcgtggtcac cttcgcgggc acagccccgc tcgtcaccac cgacaagaag       840
     gccatggtcc cccgcgaggg agaactgctc gaagtcaaag tgcccaaggg aacggggggc       900
     atgctcgtcg tcggggacga agtgctcctc gctgccgccg acggcccctg gtactgggct       960
     gcccccgggg aagagcccgc gaaagtcacg gcgaaggaac ccaagagcgc cgatggactc      1020
     gatcgggtga tcaccgcatc cgagcggtat gtcatcgttc ggtggcagag tgagaaggaa      1080
     gacaaagtca tcctggccgc ccacgacgcc cgggacggct cggtcttcgc ggagacggag      1140
     atcaccgcgg gagaactcgc cgatgccacc tggatcgaag gggagacggt ggctgcctat      1200
     ggaccgatcc tgaccgacct ggagtccgga cagactcagg tgctgccggg cttcacacca      1260
     ctcaacgctg tcgccggcgt ggtctacggc gaactggagg aaggccaagt cgcggtcaac      1320
     gcggcggggg aggtgacccc catggaaccc gacaccgccc gtccgtgggg cctgctcgac      1380
     ggccacgccg tagtcatggc cgacgccaat ctttatgcct tattgccgga ttaa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page