(data stored in ACNUC7421 zone)

EMBL: CP000088.PE364

CP000088.PE364       Location/Qualifiers
FT   CDS_pept        complement(411172..411867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0366"
FT                   /product="methylated-DNA (protein)-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54404"
FT                   /db_xref="GOA:Q47T13"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54404.1"
FT                   /translation="MRCRAENSLSPPLPHRRTPDTGTSTPAPRTHQGVIVTAEIPARAR
FT                   VHTVVDSPLGPLTLVAADGALVGLYQEDQRHRPAPDSFGVPDPAPFTEVIAQLTEYFSG
FT                   QRTVFDLPLAFTGTPFQTTVWRALLEIPYGQTVSYGELAARIGKPSASRAVGLANGRNP
FT                   ISIIVPCHRVVGSSGSLTGYGGGLARKQWLLALEQRRAHQPPLLDFADGLDAGEPRSAT
FT                   LPMGSHHSA"
     atgcggtgtc gggcggaaaa ctcactcagc ccgcctctcc cacaccggcg gacccctgat        60
     actgggacaa gtacgcccgc accgcgtacc caccaaggag tgatcgtgac cgccgaaatc       120
     ccggctcgcg cacgagtcca caccgttgtg gacagtcccc tcggcccgct gaccctggtc       180
     gccgccgacg gcgcactcgt cggcctctac caggaagacc agcggcaccg gcctgccccg       240
     gactccttcg gcgtccccga ccccgcaccg ttcaccgagg tcatcgccca actgacggag       300
     tacttctccg gtcaacgcac cgtcttcgac cttccgctgg ccttcaccgg caccccgttc       360
     caaaccacgg tctggcgtgc cctcctggag atcccctacg gacagacggt ctcctacggc       420
     gaactcgcgg cccggatcgg caaaccctcg gcgtcccgag ccgtgggact cgccaacggc       480
     cgcaacccga tcagcatcat cgtgccctgc caccgggtgg tgggctcgtc cggctcgctc       540
     accggatacg gcggtggcct ggcccgcaag cagtggctcc tcgcgttaga gcagcgccgc       600
     gcccaccaac cgcccctcct cgacttcgcc gacggcctcg atgccggaga accgcggtcc       660
     gccacgcttc cgatgggctc ccaccactcg gcgtaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page