(data stored in ACNUC7421 zone)

EMBL: CP000088.PE366

CP000088.PE366       Location/Qualifiers
FT   CDS_pept        414321..415427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54406"
FT                   /db_xref="GOA:Q47T11"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54406.1"
FT                   /translation="MPFVLDAGRSRCRATRNGTPSVSNGRSRSRTVVTAVFTLILMLVN
FT                   LVALPSAYADNEELESLREEAEQAREELEQATEEYTKRQEALEEAQDELVKTLHELQQI
FT                   EGRIADMRVPLVELAITLYKQPDVGVLGFLASDSVESDLRAESHVMKLSYDQEQLLDEA
FT                   NALRDEQIELTGRAQELQSQTQLERVELEDELEKLRKKSEESTEALTKKLEDLGLSVDA
FT                   YMAGVECDPSAAQKAIGAPNGLLPSDSLCELHVEGHYLRADAAVDFLRMNQAYAQEFGT
FT                   DMCVTSSYRDLQNQHRVYAQQPPGYAAVPGTSNHGLGLAVDLCGGVQNQGSPQFNWLEA
FT                   HAGEYNWFHPAWAYSNPFEPWHWEYDPS"
     gtgccgttcg ttctcgatgc cgggcggagt cgttgccgcg cgacgaggaa cgggacaccg        60
     tccgtctcga acggcagatc ccggtcgcgg actgtggtga ccgcggtgtt caccctcatc       120
     ctcatgctgg tgaacctcgt ggcgctgccg tccgcctacg ccgacaacga agaactggaa       180
     tccctcaggg aggaagccga acaggccagg gaggagctgg agcaggccac cgaggagtac       240
     accaagcggc aagaggcgct cgaagaagcg caggacgaac tggtcaagac gctgcatgaa       300
     ctgcagcaga tcgagggccg gatcgcagac atgcgggtcc ccctcgtcga actcgccatc       360
     acgctctaca aacagcccga cgtcggagtg ctgggtttct tggcgtccga ttcggtggag       420
     agcgacctgc gcgccgagtc gcacgtcatg aaactctcct acgaccagga gcagctcctc       480
     gacgaggcga atgcgctccg cgacgagcag atcgaactga ccggccgagc acaggaactc       540
     cagtcgcaga cccagttgga gcgggtggag ctcgaagacg agctggagaa gctgcggaag       600
     aagtcggaag agagcacgga agcgctgacg aagaaactcg aggacctggg gctttctgtc       660
     gacgcctaca tggccggggt ggagtgcgac cccagtgctg cccagaaggc gataggcgcc       720
     cccaacgggc tgctgcccag cgactccctg tgcgagctgc acgtcgaagg ccactacctg       780
     cgtgccgacg ccgccgtgga cttcctgcgc atgaaccagg cctacgccca ggagttcggc       840
     accgacatgt gcgtgaccag ctcctaccgg gacctgcaga accagcaccg cgtctacgcc       900
     cagcagccgc cggggtacgc ggcagtgccg ggaacaagca accacggcct cggcttggcg       960
     gtcgacttgt gcggcggcgt gcagaaccag gggtcgcccc agttcaactg gttggaagca      1020
     cacgctggcg aatacaactg gttccacccg gcgtgggcct actccaatcc tttcgaaccc      1080
     tggcactggg agtacgaccc ctcctag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page