(data stored in ACNUC7421 zone)

EMBL: CP000088.PE368

CP000088.PE368       Location/Qualifiers
FT   CDS_pept        416469..416753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54408"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54408.1"
FT                   /translation="MKMPVVNSCEAEACAYNTDSTCRALAITVGNQPSAYCDTFLPIQA
FT                   KGGDPSTVGHVGACKMANCQHNVQFECQAPAINIGFDANQADCLTYAPA"
     atgaaaatgc ccgtggtgaa ctcgtgtgag gcggaggcct gcgcctacaa cactgacagc        60
     acctgccgcg cactggcgat cactgtgggg aatcagccca gtgcatactg cgacactttt       120
     ctgccgatcc aggccaaggg aggcgacccc agcacggtcg gccacgtggg agcttgcaag       180
     atggccaact gccagcacaa cgtccagttc gaatgccagg ccccggccat caacatcggt       240
     ttcgacgcca accaggcaga ctgcctcacc tacgcgcccg cctaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page