(data stored in ACNUC7421 zone)

EMBL: CP000088.PE37

CP000088.PE37        Location/Qualifiers
FT   CDS_pept        complement(41749..41982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54077"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54077.1"
FT                   /translation="MRRIMKLAAVSTLAAGLLGAGASSALAGDYVEVTATETAQCISAQ
FT                   EAGGFSLLIGAGANVNALNAASCTGSVNINDN"
     atgcggcgaa tcatgaagct ggctgccgtg agcacgctgg ccgcgggtct gctcggcgcc        60
     ggggcctcca gcgccctggc cggcgactac gtcgaggtta ccgccaccga gaccgcgcag       120
     tgcatctcgg ctcaggaggc tggcggtttc agcttgctca tcggtgcggg cgcgaacgtc       180
     aacgccctca acgcggcgtc ctgcacgggc agcgtcaaca tcaacgacaa ctag             234
//

If you have problems or comments...

PBIL Back to PBIL home page