(data stored in ACNUC7421 zone)

EMBL: CP000088.PE375

CP000088.PE375       Location/Qualifiers
FT   CDS_pept        421462..422127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0377"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54415"
FT                   /db_xref="GOA:Q47T02"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54415.1"
FT                   /translation="MRGWPVSLAEGKVVLRPLRLRDAPALRETRARNSEWLRPWEPTHP
FT                   ELPPQSDSLLAYVAMVQSIRREARQGIAMPWAITWEGRFIGQITVGAITWGSARSAQIG
FT                   YWIDRDYAGRGVMPTAVALAVDHAFFTVGLHRVEANIRPENHKSRRVVEKLGFREEGLR
FT                   KRQLHIDGEWRDHLCYALTVEDVPGGLLARWRKVREQRGDTVSEKTRGASPGRPDRPH"
     atgcgtggtt ggccggtgtc gttagcggag gggaaggttg tcctgcgtcc gctccggctg        60
     cgtgatgctc cggcgctgcg cgagacccgg gcccgcaaca gtgaatggct gcgcccgtgg       120
     gagcccaccc atccagaact tccgccgcag agtgacagcc tgctcgccta tgtggccatg       180
     gtgcagtcca tccgccggga ggcccggcag gggatcgcga tgccgtgggc tatcacctgg       240
     gagggccggt tcatcggcca gatcacggtg ggggcgatca cgtgggggtc ggcgcggtct       300
     gcgcagatcg gctattggat tgaccgcgac tatgccgggc ggggtgtgat gcctaccgca       360
     gtcgcgttgg cggtcgacca tgcctttttc acggtggggc tgcaccgcgt cgaggctaat       420
     atccgcccgg agaaccacaa aagccggcgg gtcgtggaga aactcggctt tcgtgaggaa       480
     gggctccgta agcgtcagtt gcatattgac ggtgagtggc gcgatcatct ctgttacgcc       540
     cttaccgtcg aggacgttcc gggcggtttg ctcgctcggt ggaggaaggt gcgagaacag       600
     cggggcgata ccgtttcgga gaagacgcgc ggagcgtcac caggccgtcc cgaccgccct       660
     cactga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page