(data stored in ACNUC7421 zone)

EMBL: CP000088.PE379

CP000088.PE379       Location/Qualifiers
FT   CDS_pept        complement(425133..425450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0381"
FT                   /product="sec-independent protein translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54419"
FT                   /db_xref="GOA:Q47SZ8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54419.1"
FT                   /translation="MFNIGAGEFLVLSVLALLIFGPDQLPKAAAQAGRALRQLRKMADN
FT                   AKRDIREGLGPEYKDFDVADLHPKRFVQKHFWEAVDEEESSLSVSARLNGRRPPFDNEA
FT                   T"
     atgttcaaca tcggggctgg tgagttcctc gtcctgagtg tgctcgctct cctcatcttc        60
     ggccccgacc agcttcccaa agcggcggcg caggccgggc gcgcgctgcg gcagctccgg       120
     aagatggccg acaacgcgaa gcgggacatc cgcgaaggtt tgggccccga gtacaaggac       180
     ttcgacgttg ccgacctcca cccgaagcgg ttcgtgcaga agcacttctg ggaagcggtc       240
     gatgaggagg agtcgtcgct gagcgtgtcg gcccggttga acggccgccg cccgccgttc       300
     gacaacgaag cgacctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page