(data stored in ACNUC7421 zone)

EMBL: CP000088.PE38

CP000088.PE38        Location/Qualifiers
FT   CDS_pept        complement(42286..42519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54078.1"
FT                   /translation="MRRIMKLAAVGALAAGLVGAGASTAFAHDYTEITATKTAQCVAEQ
FT                   PAVGLGLLAGLGLNVNALNSASCTGSVNVNDN"
     atgcggcgaa tcatgaagct agccgctgtg ggcgcgctgg ccgcggggct cgtcggcgcg        60
     ggggcctcga ccgccttcgc ccacgactac accgagatca ccgccaccaa gacggcacag       120
     tgtgtcgctg agcagccagc agtcggcctc ggcctgctcg ccgggctggg cttgaacgtc       180
     aacgccctca actcggcgtc ctgcacgggc agcgtcaacg tcaacgacaa ctag             234
//

If you have problems or comments...

PBIL Back to PBIL home page