(data stored in ACNUC7421 zone)

EMBL: CP000088.PE383

CP000088.PE383       Location/Qualifiers
FT   CDS_pept        complement(427978..429894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0385"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54423"
FT                   /db_xref="GOA:Q47SZ4"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54423.1"
FT                   /translation="MGGEQYPPPGRRKGVGVFPRRASAAGTYSPTKRMSTTALQDKVSP
FT                   SPESQSLRERLVPALPSPAWLGWVVALVVAAFAGALRFIRLGEPAQIYFDETYYAKDAY
FT                   GLREYGYEHETVENADELLRNGVSHIFAGGGDFVVHPPFGKWLIALGDTVWGLLPFGAT
FT                   FTPTGWRFAAAVFGTLSVLLLVRITQRMTRSIVLGASAGLIMALDGLHFTLSRIAMVDI
FT                   FLTFWILAGFGCLVIDRDRTRARLAEATEAGRATVNAFTAWWWTVVADAARALAPSQTA
FT                   AESDEQTGKHAQPGLRERWAAAAAARAEQARSPEEAAVRWLGVRWWRIAAGVCLGLACG
FT                   TKWTALFYLAAFGLLTVAWDYGARRSVGQRRVWGRWLGYDAIPAFFQMVGTAFVVYLAT
FT                   WSGWLATSGGWGRQWADLTPEVQSYTGFLPGPLREAANALISLGHYHWRMWSFHKDLGE
FT                   PHDFASQPWDWIIMRVPVAFYYDGEGTDCGATACSDAILSIGTPAIWWLSILACGVMLG
FT                   WWVTYRDWRAGAALLGVAAGWLPWFAFPQRTMFLFYALPFLPFLVLAIVLMLGLMLGSP
FT                   GDRPGTSPWSRVVGSVIYGVVMLLIIANFTYLYPVLSAETIPYTEWADRMWFPTWIYGS
FT                   GGN"
     gtgggtggcg aacaataccc gccaccgggt cgacggaaag gagtcggcgt ctttcctagg        60
     cgtgcgagcg ccgcagggac gtactcgcct accaagcgca tgagcaccac agccctacag       120
     gacaaggttt ctccctcgcc tgagtcccag tcgctgcgtg agcggctggt gcccgccctg       180
     ccctcccccg cctggctggg ctgggttgtc gccctcgtcg tcgccgcgtt cgccggggcg       240
     ctccggttca tccgcctcgg tgaacccgcc cagatctact tcgacgagac ctactacgcc       300
     aaagacgcct acgggctacg cgagtatggc tacgagcacg aaaccgtaga gaacgccgac       360
     gagctgctgc ggaacggcgt ctcccacatc ttcgccggcg gcggggactt cgtggtgcac       420
     ccgccgttcg gcaaatggct gatcgccctc ggcgacactg tgtgggggct gctgccgttc       480
     ggggcgacgt tcaccccgac cggttggcgg ttcgcggcag cagtgttcgg cacgctgtcg       540
     gtgctgctgc tggtgcggat cacgcagcgc atgacccgtt cgatcgtgct gggggcgtcc       600
     gccgggctga tcatggcgtt ggacgggctg cacttcaccc tgagccgcat cgccatggtc       660
     gacatcttct tgacgttctg gatcctggcg gggttcggct gcctggtgat cgaccgggac       720
     cgcacgcggg cccggctggc ggaagccacc gaagcggggc gtgccacggt caacgcgttc       780
     accgcgtggt ggtggacggt ggtcgcggac gcggcccgcg ccttggcgcc gtcccagact       840
     gcggccgagt ccgacgagca gacaggcaaa cacgcccagc cggggctgcg ggagcggtgg       900
     gctgctgccg cggccgcccg cgccgaacag gcccgctctc ccgaagaggc cgcggtccgc       960
     tggctgggag tgcgctggtg gcggatcgct gccggggtgt gcctggggct cgcatgcggt      1020
     acgaagtgga ccgcgctgtt ctaccttgcc gcgttcggcc tgctcaccgt cgcgtgggac      1080
     tacggggcgc ggcgcagcgt gggacagcgc cgggtgtggg ggcgttggct gggctacgac      1140
     gcaatccccg cgttcttcca gatggtgggc accgccttcg tcgtctacct ggcgacgtgg      1200
     agcggctggc tggcgacgag cggcggctgg ggccgccagt gggcggacct gacccccgaa      1260
     gtccagtcct acaccggctt cctgcccggt ccgctgcgcg aggccgcgaa cgcgctgatc      1320
     agcctgggtc actaccactg gcggatgtgg agcttccaca aggacctggg ggagccgcac      1380
     gacttcgcct cccagccgtg ggactggatc atcatgcggg tcccggtggc gttctactac      1440
     gacggggaag gcaccgactg cggggcgacg gcgtgctcgg acgccatcct gagcatcggc      1500
     accccggcga tctggtggct gtccatcctg gcctgcgggg tgatgctcgg ctggtgggtg      1560
     acctaccggg actggcgggc cggtgccgcg ctgctggggg tggccgccgg gtggctgccg      1620
     tggttcgcgt tcccgcagcg caccatgttc ctcttctacg cgctgccgtt cctgccgttc      1680
     ctggtgctgg ccatcgtgct gatgctgggg ctgatgctgg ggtcgccggg ggaccgtccc      1740
     ggaacttccc cgtggtcccg ggtggtgggc agcgtcatct acggcgtggt catgctgctg      1800
     atcatcgcga acttcaccta cctgtacccg gtgttgagcg cggagacgat cccgtacacg      1860
     gagtgggcgg accggatgtg gttccccacc tggatctacg gcagcggcgg caactga         1917
//

If you have problems or comments...

PBIL Back to PBIL home page