(data stored in ACNUC7421 zone)

EMBL: CP000088.PE385

CP000088.PE385       Location/Qualifiers
FT   CDS_pept        complement(431084..433819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0387"
FT                   /product="protein translocase subunit secD / protein
FT                   translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54425"
FT                   /db_xref="GOA:Q47SZ2"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54425.1"
FT                   /translation="MTSSPGSGARWLRALISLLIMAGAFTAGWFLKPKLGLDLSGGTQI
FT                   VLETRDAEDGTKANASNTDLVVEVLRNRIDSLGVSEATLSRSGENRIIVELPGVQDPTE
FT                   AAEVLGQTAQLTIHPVLGVDQSIGTTGGGMFGDFRNAPADNSAEASDSEAQEEESPAED
FT                   EEGSEESTESGEEAEAVDPEDIALTLPDESGTLLQLGKPALTGDQVDRAEATLNELQTE
FT                   WLVNVEFKGAGREAWKKLTGEAACHSPGDPRRRIAIVLDNEIISAPEVDANDVACNVGM
FT                   SGGRTSITGGFDAEEAKELALLIEGGSLPLPVEEVQRQTVGPTLGAEAIKASFIAGLIG
FT                   IALTAIYISISYRFAGFLASVALLCYTVIAYAALVALGATLTLPGLAGFVLSIGMAIDA
FT                   NVLIFERTREEYQRQEKVYQANKSAGMLDATEKEQDEAAAGVVTRRRRRAIPPNLLKSF
FT                   TVGSQRAWSAVLDTNITTLIAAVLLFFLASGTVQGFGVTLGLGTIASMISALLIARVLM
FT                   EWTVSRFTPLRRLWLIGAAAVVVGLVAVLSDGLRVDNVLLLVSGALGVLAVSVAIIPLI
FT                   VRKFPRSSGIAHISAVRKWLVEHNPDLMKRSTLWLGITGVVTVLALLGFAVRSPNLGVE
FT                   FTGGRVMTFSVTEELNADQARELVAGAGYANAVVQEVEGGEISVRTGHISDQEAAKIQD
FT                   ALAEEGGEVERTSDEKIGPSMGSELRNKALIALIVALVLQMAYLAWRFRWSFGLATMLA
FT                   LAFDIILVIGLFVWLGKPIDGVFLAALLSIIGFSVNDSVVVFDRVRDEWAHKPKGDFRE
FT                   IANSSVLHTLPRTVNSGIGGLFILAALAVLGGSSLTDFSIAMLVGLISGIFSTVFVAVP
FT                   LAIWLQRFDRTPPPHEVKERKTKQRKQQRAIRERTDGAVV"
     ttgactagtt caccgggatc gggggcgcgc tggctccgcg cgctcatatc cctgctcatc        60
     atggccggcg cgttcactgc cggctggttc ctgaagccga agctcgggct cgacctgagc       120
     ggcggcaccc agatcgtctt ggaaacccgg gacgccgagg acggcaccaa ggccaacgcg       180
     tccaacactg acctcgtcgt cgaggtgctg cgcaaccgca tcgactcgct cggggtcagc       240
     gaagccaccc tctcgcgctc cggggagaac cggatcatcg tcgaactccc cggtgtgcaa       300
     gaccccaccg aggccgccga agtgctgggg cagaccgccc agttgaccat ccacccggtg       360
     ctgggcgtgg accagagcat cggcaccacg ggcggcggga tgttcggcga cttccgcaac       420
     gccccagctg acaacagcgc ggaagcctcc gactccgagg cgcaggagga ggagagcccg       480
     gccgaagacg aggaaggctc ggaagagtcc accgagtccg gggaagaagc cgaggccgtc       540
     gacccggagg acatcgcgct gaccctgccc gacgagtccg gcaccctgct ccagttgggc       600
     aagcccgcgc tcaccggcga ccaggtggac cgggctgagg ccacgctcaa cgagctgcag       660
     accgagtggc tggtcaacgt cgagttcaag ggtgctggcc gggaagcctg gaagaagctg       720
     accggtgagg ctgcctgcca ctcgcccggc gacccgcggc ggcgtatcgc gatcgtcctc       780
     gacaacgaga tcatctccgc gcccgaggtg gacgcgaacg atgtggcttg caacgtcggc       840
     atgtccggtg gccgcacctc gatcaccggc gggttcgacg ctgaagaggc caaagagctg       900
     gccctgctga tcgaaggcgg ttccctgccg ctgcccgtgg aagaagtgca gcggcagacg       960
     gtcggcccga ccctgggtgc cgaggccatc aaggccagct tcatcgccgg tctcatcggt      1020
     atcgcgctga ccgcgatcta catcagcatc tcctaccggt tcgcgggctt cctcgcctcg      1080
     gtggcgctgc tgtgctacac ggtcatcgcc tacgcggcgc tggtggcgct gggtgccacg      1140
     ctcaccctgc cgggtctggc cggtttcgtc ctgtccatcg gtatggcgat cgacgccaac      1200
     gtgctgatct tcgagcggac ccgcgaggag tatcagcggc aggagaaggt ctaccaggcc      1260
     aacaagtccg cgggcatgct ggacgccacc gaaaaggagc aggacgaggc ggctgccggc      1320
     gtggtaaccc gccgtcgccg ccgcgcgatc ccgccgaacc tgctcaagtc gttcacggtc      1380
     ggttcgcagc gggcgtggag cgcggtgctg gacaccaaca tcaccacgct catcgctgcg      1440
     gtcctgctgt tcttcctcgc ctccggtacc gtccagggct tcggtgtgac cctgggcctg      1500
     ggcacgatcg cgtcgatgat ctcggcgctc ctcatcgccc gcgtgctcat ggagtggacg      1560
     gtgtcccgct tcactccgct gcgccggctg tggctgatcg gtgccgcggc cgtggtcgtg      1620
     ggcctggtgg cggtgctgtc cgacgggctg cgtgtcgaca acgtgctgct gctcgtctcc      1680
     ggcgcgctgg gtgtgctcgc ggtctctgtg gcgatcattc cgctgatcgt gcggaagttc      1740
     ccgcggagca gcggtatcgc ccacatcagc gcggtccgca agtggctggt ggagcacaac      1800
     ccggacctga tgaagcgcag cacgctgtgg ctgggcatca ccggtgtcgt caccgtgctg      1860
     gcgctgctcg gcttcgcggt gcgctccccc aacctgggtg tggagttcac cggcggccgg      1920
     gtgatgacct tctccgtcac cgaggagctc aacgccgacc aggcgcggga gcttgtcgcg      1980
     ggcgcgggct acgcgaacgc ggtggtccag gaggtcgagg gcggcgagat ctccgtgcgc      2040
     accgggcaca tctccgacca ggaggccgcg aagatccagg atgccctcgc cgaggaaggc      2100
     ggcgaggtcg agcggaccag cgacgagaag atcggcccga gcatgggcag cgagctgcgc      2160
     aacaaggcgc tgatcgcgct gatcgtggcg ctggtgctgc agatggccta cctggcgtgg      2220
     cggttccgct ggtcgttcgg cttggcgacc atgctggcgc tggccttcga catcatcctg      2280
     gtgatcggcc tgttcgtgtg gctgggtaag ccgatcgacg gcgtgttcct cgccgcgctg      2340
     ctgagcatca tcggtttctc ggtgaacgac tcggtggtgg tgttcgaccg ggtgcgcgac      2400
     gagtgggcgc acaagccgaa gggcgacttc cgcgaaatcg cgaactcgtc ggtcctgcac      2460
     acgctgccgc ggaccgtgaa ctcgggtatc ggcggcctgt tcatcctggc cgcgctggcg      2520
     gtgctcggcg gttcgtcgct caccgacttc tcgatcgcga tgctggtcgg tttgatctcc      2580
     ggcatcttct ccacggtgtt tgtggcggtg ccgctggcga tctggttgca gcggttcgac      2640
     cggacaccgc cgccgcacga ggtcaaggag cgcaagacca agcagcgcaa gcagcagcgt      2700
     gcgatccggg agcggaccga cggcgccgtc gtgtag                                2736
//

If you have problems or comments...

PBIL Back to PBIL home page