(data stored in ACNUC7421 zone)

EMBL: CP000088.PE388

CP000088.PE388       Location/Qualifiers
FT   CDS_pept        complement(436528..436962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54428"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54428.1"
FT                   /translation="MPATFTESNNFDTDRNQDARLAALIRQLAEIRPEILHPAAPTPQP
FT                   ASRPAPQSTARPPRPLRPHPTDPASPHHITYLRALSCGTHKPGQYWPAHATQEYYARKL
FT                   RLWLRRRIAYAGHDAKPAITAALAFTAGCLLTLLGTTVLT"
     atgcctgcaa ccttcacgga aagcaataat ttcgacaccg atcgaaacca ggacgcccgc        60
     ttggcggccc tcatccgcca gctcgccgag atacgccccg agatcctcca cccggccgcg       120
     cccacaccac agcctgcgtc ccggcctgca ccgcagagca cggcgcgtcc cccgcggccg       180
     ctccgcccgc acccgaccga tccggcctcg ccccaccaca tcacctacct gcgcgccctg       240
     tcctgcggca cgcacaagcc cggccagtac tggcccgccc acgccaccca ggagtactac       300
     gcccgcaaac tccgcctctg gctgcgccgc cgcatcgcat acgccggcca cgatgccaaa       360
     cccgccatca cagcggcgct cgccttcacc gcaggctgtc tgctcaccct gctcggcacc       420
     acagtcctga cgtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page