(data stored in ACNUC7421 zone)

EMBL: CP000088.PE399

CP000088.PE399       Location/Qualifiers
FT   CDS_pept        447298..448740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54439"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54439.1"
FT                   /translation="MYEEDARQRFWLCLPADVRARLSVAGDPYGFALSLVIQCCDQQRL
FT                   GVMLRWLRCLENDSKPAMQVCELAEGLLEAEEWELSGQGRERDTWEQLRKALREVPYDD
FT                   QVDLLCQRVVPLPPEQIEAPSPRNAWEAFLDLKEATLGPRGEDPGERFLQLLAEYTGRA
FT                   ELVRAVAEWGADQRHATVVKRSGWGGGEPFRPLPPPRLIIKIGYDLGNLERLSVAYRLV
FT                   TDPDDDWMDVCEAEALTEVTEEELPRRISELIIWAESQQAADHGKLRLEFIFPFSLLFR
FT                   FVVQNWPLELHEDAPAPSLGSQYEIIIRSEEFARDPRAQRICQRRWQNLHEGRGRVGSS
FT                   STVLEEGWENVANYLGNEAIVAFVAYALPGVDWQRQVYAAVICGVPVVAWRWMGKNGNP
FT                   EAHFLSILRGEEEMASGKQEMNGLERGIKNLTKNLYLSRINRGTAEMRNRSRQSYDLSV
FT                   IYHDYQPKPREQRQVLSGGNIR"
     gtgtacgagg aggatgcgcg ccagcggttc tggctttgcc tgcccgcgga tgtgcgggcc        60
     cggctcagcg tggcaggaga cccgtacggg tttgcgcttt ccctggtcat ccagtgctgc       120
     gaccagcagc ggctcggggt gatgctgcgc tggctccgct gcttggagaa cgactccaag       180
     ccggcgatgc aggtgtgcga gctggctgag gggctgctgg aagcggaaga gtgggagctc       240
     agcgggcagg ggcgggaacg ggacacgtgg gagcagctcc gcaaagcgct gcgtgaggtg       300
     ccctacgacg accaggtcga cctgctctgt cagcgggtgg tgccgctgcc cccggagcag       360
     atcgaggcgc cgtccccgcg taacgcgtgg gaggcgttcc tcgatttgaa agaggccacg       420
     ctcggcccgc ggggggagga tcccggggag cggttcctgc agcttctcgc ggagtacacg       480
     ggccgtgcgg agctggttcg ggcggtggcg gagtggggcg cggaccagcg gcatgcgacg       540
     gtagtgaagc gctccgggtg gggcggcggg gagccgttcc ggccgcttcc tccgccgcgg       600
     ctcatcatca agatcggcta cgacttgggg aatcttgagc ggctctcggt cgcctaccgg       660
     ctggtgacgg atccggacga cgactggatg gacgtgtgcg aggccgaggc gttgaccgag       720
     gtgacggagg aggagctgcc gcggcggatc tccgagctga tcatttgggc ggaaagccag       780
     caggccgctg accacggaaa actccgattg gagtttatat ttccgttttc gctacttttc       840
     aggtttgttg tccaaaattg gccgctggag cttcacgagg acgcgcccgc gccgagcctg       900
     ggctcccaat acgagatcat cattagaagc gaagaattcg cgcgcgaccc ccgagcacag       960
     cggatatgcc agcggcgctg gcagaatctg cacgaaggac gaggccgcgt cggcagctcc      1020
     tcaactgtgc tggaagaggg ctgggagaat gtggcgaatt atctcggcaa cgaggctatt      1080
     gtggctttcg tcgcctatgc gcttcctggg gtcgactggc agcgccaggt gtacgctgcc      1140
     gtgatctgcg gagttccggt ggtggcgtgg cggtggatgg ggaagaatgg caaccccgag      1200
     gctcatttcc tgtccatcct ccgaggtgaa gaggaaatgg ccagcggaaa acaggagatg      1260
     aacgggctgg agaggggtat caagaatcta accaagaacc tgtatctctc ccgaatcaac      1320
     cggggtacag cagagatgcg gaacaggtcg cgacaaagct acgacctgtc cgtcatctac      1380
     cacgactacc agccgaaacc ccgggaacag aggcaggtgc tctccggcgg caacattcga      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page