(data stored in ACNUC7421 zone)

EMBL: CP000088.PE4

CP000088.PE4         Location/Qualifiers
FT   CDS_pept        4988..6121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54044"
FT                   /db_xref="GOA:Q47U20"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47U20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54044.1"
FT                   /translation="MHVSHLQLADYRSYEAAYLELEPGVSTFIGPNGQGKTNLVEAIGY
FT                   VATHSSHRVAHDAPLVRRGAQRAVIRAAVVRHGQTALIELEINPGRANRARLNRSPNTR
FT                   MRDVLGILHTVLFAPEDLALVKGDPGERRRFLDELLTARAPRYAGVRSDYERVLKQRNA
FT                   LLKSAAAQNLHHRGGRDLPTLDVWDEHLAQIGAELLAARLALVAELQPLAAKAYGELTA
FT                   TQDPISLRYRCSATDEELDTTNRPQLVEILRAALLRARPDELRRGVSLVGPHRDDLQLW
FT                   LNDLPAKGYASQGESWSYALALRLAGFELLRADGDDPVLLLDDVFAELDAERRRRLASY
FT                   VRTAEQVLVTAAVPDDVPQELSGARFRVTGGSVERER"
     atgcacgtct cccaccttca gttggccgac taccggtcct acgaggccgc gtacctggag        60
     ctggagccgg gagtcagcac cttcataggc ccgaacgggc agggcaagac caacctggtc       120
     gaagcgatcg gctacgtcgc cacccatagc agccaccgcg tggcccacga cgctcccctc       180
     gtccgccgag gagcccaacg agccgtcatc cgcgcggccg tggtccgcca cggccaaact       240
     gccctcatcg agctggagat caaccctggg cgggccaacc gcgcccgcct gaaccgctcc       300
     cccaacaccc ggatgcgcga cgtcctcggc atcctccaca ccgtcctgtt cgcccccgaa       360
     gacctggccc tggtcaaagg agacccgggg gagcgccgcc gcttcctcga cgagctgctg       420
     accgcccgcg ccccccggta cgcgggggtg cgctccgact acgaacgcgt cctcaaacag       480
     cgcaacgcgc tcctcaaatc cgcagccgcc caaaacctcc accaccgggg cggccgcgac       540
     ctgcccacgc tggacgtgtg ggacgagcac ctcgcccaga tcggcgcgga actcctcgcg       600
     gcacggctcg ccctggttgc ggaactccag cccttggccg cgaaagccta cggcgaactc       660
     accgccaccc aagacccgat cagcctgcgc taccgctgct cggccactga cgaggagctc       720
     gacaccacca accgtccaca gcttgtggaa atcctgcgcg ctgcactgct gcgcgcccgc       780
     cccgacgaac tgcggcgcgg tgtcagcctc gtcggccccc accgcgacga cctgcagctg       840
     tggctcaacg acctgccagc caagggctat gccagccaag gcgaatcctg gtcgtacgcc       900
     ctcgcgctgc ggctcgccgg cttcgaactg ctccgcgccg acggcgacga ccccgtcctc       960
     ctcctcgacg acgttttcgc ggaactcgac gctgagcggc ggcgccgcct cgcctcttac      1020
     gtccgcaccg cggaacaagt cctcgtcacc gctgccgtac ccgacgatgt cccccaagaa      1080
     ctctccgggg cacgattccg ggtcacagga gggagcgtgg aacgtgaacg gtga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page