(data stored in ACNUC7421 zone)

EMBL: CP000088.PE404

CP000088.PE404       Location/Qualifiers
FT   CDS_pept        complement(456285..458159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0406"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54444"
FT                   /db_xref="GOA:Q47SX3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54444.1"
FT                   /translation="MPSDGLPKNLEPLAAGDPATIGPYVLVGRLGSGGMGTVYLGRAPE
FT                   KGTHVAIKVIRPELAFDEATRARFRDEMENARKVASFCTAKVLDHGTFQNRPYMVTEYI
FT                   AGTALAEHIAEHGPLDSGTLHGFALGVAAALAAIHKAGLVHRDLKPANVLLSLSGPRVI
FT                   DFGIARALNTSTSHTQTGIVMGSPGWMAPEQLLEEKVTTKADIFAWGCLVAFAGNGRHP
FT                   FGNGDAMTLGKRMLFAEPDIGNLDPPLDRLVARALAKDPDQRPTAQELLLELAGGTDSN
FT                   DTNDVVSHALHQSWRPNFPPMPPGYPPPSPQAHSGMPGPQAQAQAPGQTTIAPQPYAHP
FT                   QQGGPGPMPPQAAGPQGGPQGGPQSPPMPQRPGPQASHHTGQIPVVPPTTGRQPPRSPA
FT                   AQGSSGGPQARPYVPPNTLPPHRPLRPDSSRSRLLIVFAVLGAVLLAVVLVFGLVFFQD
FT                   WFSSTSDTNPPGQGQEQQSSAPKEDPDDESDKSDTQAADPQAGESLRFDLLDWYCGNQV
FT                   LDRPLIVNGGEYCVAEIEAHNSANYPVKFRHDLQILAHASGEQTKADAPLHGEGADPLW
FT                   AGPIQPGDTVRGYLVFIVHSELTPEVLILRSTVDSPGQQIEIPSGQPA"
     ttgccgtcgg atgggctccc gaagaacttg gaaccgctgg ccgccggaga cccggcgacc        60
     atcggtcctt acgtgctggt cggacgtcta ggcagcggag gcatggggac ggtctacttg       120
     ggccgcgccc cggagaaggg aacccatgta gcgatcaagg tcatccgccc cgaactcgct       180
     ttcgacgagg ccacccgggc gcgtttccgc gacgagatgg aaaacgcccg caaagtcgcc       240
     tccttctgca cggctaaggt gctcgaccac ggcaccttcc aaaaccggcc gtacatggtc       300
     accgagtaca ttgcgggcac ggccctcgcc gagcacatcg ccgagcacgg tccgctcgac       360
     tcgggcaccc tgcacggttt cgcattgggg gtggccgcgg cgctcgccgc gatccacaag       420
     gccggtctgg tccaccgcga cctgaaaccc gccaacgtgc tgctgtccct gtccgggccg       480
     cgggtgatcg acttcggtat cgcccgggcg ctgaacacgt ccacgagcca cacccagacg       540
     gggatcgtca tgggcagccc ggggtggatg gcccccgagc agttgctgga agaaaaggtc       600
     accaccaagg ccgacatttt cgcttggggc tgcctggtgg cgttcgcggg caacggccga       660
     cacccgttcg gcaacggcga cgccatgacc ctcggcaagc ggatgctgtt cgcagagccc       720
     gacatcggga acctggaccc gccgctggac cgcctcgtcg cccgggcgct ggcgaaggac       780
     cccgaccagc gtcccaccgc ccaggagctg ctgctggagc tggcaggggg cacggacagc       840
     aacgacacca acgacgtggt cagccatgcc ctgcaccagt cgtggcggcc gaacttcccg       900
     ccgatgcccc ccgggtatcc gccgccgtcc ccccaggcgc actcggggat gcccggcccg       960
     caagcccagg cccaggcgcc ggggcagacc accatcgccc cccagcctta cgcgcatccc      1020
     cagcaagggg gcccggggcc gatgccaccg caagccgctg gcccccaagg cggcccgcag      1080
     ggcggtccgc aaagcccgcc gatgccgcag cggccgggac cgcaagcttc ccaccacacc      1140
     ggccagatcc ccgtggtgcc gcccaccact ggaagacagc cgccccgctc ccctgccgcc      1200
     cagggctctt cgggaggccc tcaggcccgc ccgtacgtgc cgcccaacac gcttcctcca      1260
     caccgcccgc tccgccccga cagctcccgt tcccggctgc tgatcgtctt cgcggtgctc      1320
     ggcgcggtgc ttctggctgt ggtcctcgtg ttcggcctgg tcttcttcca ggactggttc      1380
     tcctccacta gtgacaccaa tccccccggt caagggcagg agcagcagtc gtcggctcct      1440
     aaggaagacc ccgacgacga gtcggacaag tccgacaccc aggcagcgga tccgcaggcg      1500
     ggggagagtc tgcgcttcga cctcctcgac tggtactgcg gcaaccaggt gctggaccgg      1560
     ccgctcatcg tcaacggcgg cgaatactgt gtcgcggaaa tcgaggcgca caattctgcg      1620
     aactacccgg tgaagttccg gcacgacctg cagatcctgg cgcatgcgag cggcgagcag      1680
     accaaggccg acgcgccgct gcacggggag ggagccgacc cgctgtgggc gggaccgatc      1740
     cagccgggcg acaccgtgcg cggatacctg gtgttcatcg tgcactcgga gctgaccccc      1800
     gaggtcctca tcctccgcag cacggtggac agccctggcc agcagatcga gatcccctca      1860
     ggacagcccg cttaa                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page