(data stored in ACNUC7421 zone)

EMBL: CP000088.PE408

CP000088.PE408       Location/Qualifiers
FT   CDS_pept        complement(461805..462710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54448"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54448.1"
FT                   /translation="MRRFAWICTAAAVALLAASCSSEDNNAAEMQYYLSLGDGLTVGAQ
FT                   PDDSGDVLETATGYTNLVASALSKEPPGVQHVNLGCIGETTITFLSGGAEGCEYDEGSQ
FT                   LDAAVEFLEQHKGKVRLITISIGGENLFSCARDEDGALTTDIDRECVSENLQKVSEDAP
FT                   IIAQRLREAAGDDVEIIALTAYNPLLAMYLQEEVTEVVATEDDDERTYQDTANYTNGML
FT                   AAINGTLNDAYNAENITVANVATLFDVDNFEENDDGTPANVHNVCQYTWMCDTERGPDI
FT                   HLNQEGAQEVATLVQDVMRE"
     atgcgccggt ttgcttggat atgtaccgcc gcagcagtag ccctgctggc cgcaagctgc        60
     agctccgaag acaacaacgc agcggagatg cagtactacc tgtcgctggg tgatggtctg       120
     acagtcggag cccagcctga cgactcgggc gacgtcctcg aaaccgccac gggctacacc       180
     aacctggtgg cctcagccct gtcaaaggag cctccggggg tgcagcacgt caacctgggg       240
     tgcatcggag agaccaccat caccttcctc agcggtggcg ctgaaggctg cgaatacgac       300
     gagggctcgc agctggacgc cgccgtggag ttcctggagc agcacaaggg caaggtgcgc       360
     ctcatcacga tcagcatcgg cggcgagaac ctgttctcgt gcgcccggga cgaggacggc       420
     gcgctgacca ccgacatcga ccgggagtgc gtctccgaaa acctgcagaa ggtctccgag       480
     gacgcgccga tcatcgccca gcggctgcgg gaagccgcgg gcgacgacgt cgaaatcatc       540
     gcgctcaccg cctacaaccc gctgctcgcg atgtacctgc aggaagaggt gaccgaggtc       600
     gtcgccacgg aggacgacga cgagcgcacc taccaggaca ccgccaacta caccaacggc       660
     atgctggccg cgatcaacgg caccctcaac gacgcctaca acgccgagaa catcaccgtg       720
     gcgaacgtgg ccacgctgtt cgacgtggac aacttcgaag agaacgacga cggcacgccc       780
     gccaacgtcc acaacgtgtg ccagtacacg tggatgtgcg acaccgagcg cggcccggac       840
     atccacctca accaggaagg ggctcaggag gtcgccaccc tcgtccagga cgtgatgcgg       900
     gagtag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page