(data stored in ACNUC7421 zone)

EMBL: CP000088.PE409

CP000088.PE409       Location/Qualifiers
FT   CDS_pept        complement(462889..463383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0411"
FT                   /product="regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54449"
FT                   /db_xref="GOA:Q47SW8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54449.1"
FT                   /translation="MRDEVDGLVEAWRTERPDLDVAPLQVLSRVSRLARHLDRARRSVF
FT                   AAHDLEPWEFDVLAELRRSGHPYELSPGRLMRATLVTSGTMTNRIDRLTEDGLVRRLPD
FT                   PTDRRGVLVRLTDEGRERVDAALADLLRYEESLLAALTTAERDQLATLLRTVLAPLDEP
FT                   D"
     atgcgtgacg aggttgacgg tctagtcgag gcgtggcgca ccgaacgtcc cgatcttgac        60
     gtagcgccgc tgcaagtcct gagccgggtc tctcggctgg cccgccacct cgaccgtgcg       120
     cgccgttcgg tcttcgccgc ccacgacctg gagccgtggg agttcgacgt cctcgccgaa       180
     ctgcgccgct ccggtcaccc ctacgagctg agccctgggc ggctcatgcg cgccaccctc       240
     gtgacctcgg ggaccatgac caaccggatc gaccggctca ccgaggacgg cctcgtgcgc       300
     cgcctgccgg acccgaccga ccggcgaggc gtcctggtcc ggctcaccga cgaggggcgg       360
     gaacgcgtgg acgcggccct cgccgacctc ctccgctacg aggagtccct cctcgccgcg       420
     ctcaccacgg ccgaacgcga ccagttggcc acgctgctgc ggaccgtcct cgcccccctg       480
     gacgaaccgg actga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page