(data stored in ACNUC7421 zone)

EMBL: CP000088.PE414

CP000088.PE414       Location/Qualifiers
FT   CDS_pept        468906..469490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0416"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54454"
FT                   /db_xref="GOA:Q47SW3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54454.1"
FT                   /translation="MSEVRIAAEPRTEFGKGAARRARRAGKVPAVLYGHGIAPRHINLP
FT                   GHDLMLALKTPNVLLRLEGVDEKESLVLPKSVQRDPIKGFLEHVDLLVVQRGEKVVVEV
FT                   PLLVKGEVGAGGVLNLEMAQAEVRAEATRIPEGIEVDVDGLPIGTNVTAGDLKLPEGVE
FT                   LAMDPETIVMSVVAEAAPEATEEEEEGEAAE"
     gtgtccgagg tacgtatcgc tgccgagccg cgcaccgagt tcggtaaggg cgctgcacgc        60
     cgcgcccgtc gcgcgggcaa ggtgccggcc gtcctctacg gccacggcat cgctccccgc       120
     cacatcaacc tgccaggcca cgacctgatg ctcgctttga agaccccgaa cgtgctgctg       180
     cgtctggagg gtgtcgacga gaaagagagc ctcgtgctgc ccaagagcgt gcagcgcgac       240
     cccatcaagg gtttcctcga gcacgtggac ctgctggtcg tgcagcgggg cgagaaggtc       300
     gtggtcgagg ttccgctgct ggtgaagggc gaggtcggcg ctggcggtgt cctcaacctg       360
     gagatggctc aggccgaggt gcgcgccgag gccacccgta tccccgaggg gatcgaggtg       420
     gacgtggacg gactcccgat cggcacgaac gtcaccgctg gtgacctgaa gctccccgag       480
     ggcgtcgagc tggccatgga ccccgagacg atcgtcatgt ccgtggtcgc cgaggccgct       540
     cccgaggcca ccgaggagga agaggaggga gaggccgccg agtaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page