(data stored in ACNUC7421 zone)

EMBL: CP000088.PE419

CP000088.PE419       Location/Qualifiers
FT   CDS_pept        complement(473392..473883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54459"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54459.1"
FT                   /translation="MSPVLLVAASSGYPAQLWPPRPWWHRNERFWITLRTADAAARAAD
FT                   PRPSHSRSAFHRAAALTRTTLTALRVFTRYRPVMVVVTETRKTPFLFFARLFGVPTLAV
FT                   EVHDWVTTATRTALLCRPTTARPGLGARRMSAADTAAPQRSLRRPRRGARRRIGRCQPA
FT                   "
     gtgtcccctg tcctccttgt cgcagccagc agcggctacc ccgcacaatt gtggcccccg        60
     cgcccctggt ggcacaggaa cgaacgattc tggatcaccc tgcgcactgc cgacgccgcc       120
     gccagggccg ctgatccacg gccgtcccac tcccgctcgg cattccaccg cgccgccgct       180
     ctgacccgca ccaccctcac ggcgctccgc gtcttcaccc ggtaccggcc ggtcatggtc       240
     gtcgtcaccg aaacgcggaa gaccccgttc ctcttcttcg cccgcctctt cggcgtgccc       300
     accctcgccg tcgaagtcca cgactgggtc accaccgcga cccgcaccgc actgctgtgc       360
     cgccccacga ccgcccgccc cggcctggga gcgcggcgga tgagcgccgc agacaccgcg       420
     gcgccgcagc gcagcctccg tcggccccgc cgcggcgccc gccgcaggat aggacgctgt       480
     cagccggcct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page