(data stored in ACNUC7421 zone)

EMBL: CP000088.PE42

CP000088.PE42        Location/Qualifiers
FT   CDS_pept        complement(45983..46582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0044"
FT                   /product="DNA replication and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54082"
FT                   /db_xref="GOA:Q47TY2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54082.1"
FT                   /translation="MYEGAVQNLIDELGRLPGVGPKSAQRIAFHLLAAETADVHRLVNA
FT                   LVAVKERVRFCAVCGNIAEETQCRICRDPRRDDTVICVVEEPKDVVAIERTREFRGRYH
FT                   VLGGAISPIEGVGPDDLRVKELMARLSEGRVTEVILATDPNLEGEATATYLARLLKPMG
FT                   LKVTRLASGLPVGGDLEYADEVTLGRAFEGRRALDF"
     atgtacgaag gcgcggttca gaatctgatc gacgagcttg ggcggctgcc tggcgtcggt        60
     ccgaaaagcg cgcagcgtat tgccttccac ctgctcgccg cggagaccgc tgacgttcac       120
     cgtctggtca acgcgcttgt cgcggtcaag gagcgggtcc ggttctgtgc cgtgtgcggc       180
     aacattgccg aggagaccca gtgccggatc tgccgtgacc cgcgtcggga cgacacggtg       240
     atctgtgtcg ttgaagagcc gaaggatgtc gtggctatcg agcggacgcg ggagttccgc       300
     ggccgctacc acgtgctcgg tggtgcaatc agcccgatcg agggcgtggg ccccgacgat       360
     ctgcgtgtga aagagctgat ggcgcgcctc tccgaaggcc gggtcaccga ggtgattctc       420
     gccacggacc cgaacctgga gggtgaggcg accgccacct atctggcacg ccttctgaaa       480
     cccatggggc tgaaggtcac ccggctcgcc agtggcctgc ccgtgggagg cgacctcgag       540
     tatgcggacg aggtcaccct gggccgggcc ttcgaaggcc gccgagccct cgacttctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page