(data stored in ACNUC7421 zone)

EMBL: CP000088.PE427

CP000088.PE427       Location/Qualifiers
FT   CDS_pept        485229..485768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54467"
FT                   /db_xref="GOA:Q47SV0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54467.1"
FT                   /translation="MVKVPDPSSGRRPRTTGGSPSGASKPSKAAGKKSPGGRTRPAAAA
FT                   ASRGRRTAAQASSRPALTSRAAVLALLVCVIALSLAYPLREYIAQRARIAQLKEERARI
FT                   QESVAELTARYEELQDPAYIEREARSRLHYQYPGEQTYIIIGGTPEEEAVPERSPSNPW
FT                   FVELWDSVAEADQPQG"
     gtggtgaagg tgccggaccc gtccagtggc cgccgtccgc gtacgacggg gggctcaccg        60
     tccggtgcct cgaaaccgtc gaaggccgcc gggaagaagt cccccggcgg ccggacccgg       120
     cccgcggccg ccgcggcgtc ccgcggccgc cgcaccgccg ctcaggcgag cagcaggccg       180
     gcgttgacca gccgggccgc agtccttgcg ctgctggtct gcgtgatcgc actgagcctg       240
     gcttatccgc tgcgcgagta cattgcccag cgggcgcgga tcgcccagtt gaaagaggag       300
     cgggcgcgga tccaggagtc ggttgcggag ctgaccgcgc gctacgagga gctccaagac       360
     cccgcctaca tcgagcggga agcgcgttcg cggctgcact accagtaccc gggcgagcag       420
     acctacatca tcatcggcgg caccccggaa gaggaggccg tgccggagcg cagcccgtcc       480
     aacccgtggt ttgtcgaact gtgggattcg gtggcggaag ccgaccagcc gcaaggctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page