(data stored in ACNUC7421 zone)

EMBL: CP000088.PE43

CP000088.PE43        Location/Qualifiers
FT   CDS_pept        complement(46682..47032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0045"
FT                   /product="Conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54083"
FT                   /db_xref="GOA:Q47TY1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54083.1"
FT                   /translation="MNPGGGLDMQAILQQAQQMQQQLMAAQQELDETKVTGSSGGGLVS
FT                   VTMNGRGQVEDVSIDPKAVDPDDAAETAQTIADLVLAAIRDGERMVEEIQQQKMGPLAQ
FT                   GLGGGFPGLPGL"
     gtgaatcctg gtggcggatt ggacatgcag gcgatcctgc agcaggccca gcagatgcag        60
     cagcagctca tggcggccca gcaggagttg gatgagacca aggtgacggg ctcttccggt       120
     ggcggtctgg tcagtgtcac catgaacggg cgcggacagg tggaggacgt gtccatcgac       180
     ccgaaagcgg tggaccctga tgacgctgcg gagaccgcgc agacgattgc ggacctggtg       240
     ctggcagcga tccgcgacgg tgagcgtatg gtggaagaga tccagcagca gaagatgggt       300
     ccgctcgccc aagggttggg cggtggtttt cctgggcttc ccggtctgtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page