(data stored in ACNUC7421 zone)

EMBL: CP000088.PE441

CP000088.PE441       Location/Qualifiers
FT   CDS_pept        complement(502827..504254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0443"
FT                   /product="magnesium chelatase subunit ChlI"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54481"
FT                   /db_xref="GOA:Q47ST6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54481.1"
FT                   /translation="MNRLEGVPDHVDLPHTLGALRASGHRYRSVKDEIRENLLHRIRSG
FT                   EERFPGIVGFSETVLPQLERALLARHDVVLLGERGQGKTRLIRTLTGLLDEWSPAVAGC
FT                   ALNDHPYAPVSPQARRMVAEYGDDLPIVWRHRDERYSEKLATPDTSVGDLIGDIDPVKL
FT                   AEGRSLGDPETVHYGLVPRSNRGVFCLNELPDLAARVQVALFNVLEERDVQIRGYQLRL
FT                   PLDMLVVASANPEDYTNRGRIITPLKDRFGAEIRTHYPVELDDEIALIEQESRLSPEVR
FT                   VPPHLVEAVARFTRLVRESPSVDERSGVSARFAIAAVETVAASAERRAAMTGEQAVARV
FT                   CDLPCITAVLRGKVEFDLSEEGRENAVLEHLLNRAVYDTFRRVFSGVDLGPLTERFSSG
FT                   AAVESGDLVSAEELLARVGPFTGLAELVKRVAPDSDDDPVSAPGYAAAAVELALEGLYL
FT                   SRRLSKDTLPHGARYRI"
     gtgaatagac tcgaaggtgt gcccgatcac gtcgaccttc cgcacaccct gggcgcgttg        60
     cgcgcttcgg ggcaccgcta ccggtcagtc aaagacgaaa tccgcgaaaa tctcctgcat       120
     cggatccggt cgggggagga acgcttcccc gggatcgtgg ggttctctga aaccgtactg       180
     ccgcaactcg aacgggccct ccttgcccgg catgacgtgg tgctcctggg tgaacgtggc       240
     cagggaaaga cacggctgat ccgtacactc acgggtctgc tggacgagtg gagcccggcc       300
     gtggcgggct gcgcgctcaa cgaccacccc tacgcgccgg tctcccctca agcccgtcgg       360
     atggtcgctg aatacggcga cgacctgcct atcgtgtggc ggcaccgcga cgagcggtac       420
     agcgagaagc tggcgacccc cgacaccagc gtcggcgacc tcatcggcga catcgacccg       480
     gtcaaactcg cggaagggcg tagcctcggc gacccggaga cggtgcacta cggcctggta       540
     ccgaggtcga accggggcgt gttctgcctc aacgagctgc ccgacctggc cgcgcgcgtc       600
     caggttgcgc tgttcaacgt gcttgaagag cgggacgtgc agatccgcgg ctaccagttg       660
     cggctgccgt tggacatgct cgtggtggcg agcgccaacc cggaggacta caccaaccgg       720
     ggccggatca tcaccccgct caaggaccgg ttcggcgcgg agatccgcac ccactacccg       780
     gtggagctcg acgacgagat cgccctgatc gaacaggaga gccggctgtc gccggaggtg       840
     cgtgtccccc cgcacctggt ggaagcggtc gcccggttca cccggctggt gcgcgagtcc       900
     ccgtccgtgg atgaacgctc cggggtgtcg gcccggttcg cgatcgccgc agtggagacg       960
     gtggctgcct ccgcggagcg ccgtgccgcg atgactggcg agcaggcggt ggcgcgggtc      1020
     tgtgacctgc cgtgcattac ggcggtgctg cgcggcaagg tggagttcga cctgtccgag      1080
     gagggccggg agaacgcggt cttggagcac ttgctgaacc gcgccgtcta cgacacgttc      1140
     cgtcgtgtct tcagcggagt ggacttggga ccgctcaccg agcgcttctc ctccggtgcg      1200
     gccgtggagt cgggggatct ggtgagtgcg gaagagctcc tcgcacgggt gggcccgttc      1260
     accgggctgg cggagctcgt caagcgggtc gccccggaca gcgacgacga tccggtgtcg      1320
     gctcccggct atgcggcggc cgcggtggaa ctcgcgttgg agggcctgta tttgagccgg      1380
     aggctgtcga aggacacgct gccgcacggg gcccggtacc ggatctga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page