(data stored in ACNUC7421 zone)

EMBL: CP000088.PE45

CP000088.PE45        Location/Qualifiers
FT   CDS_pept        complement(49207..52773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0047"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54085"
FT                   /db_xref="GOA:Q47TX9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54085.1"
FT                   /translation="MTNDPFVHLHVHTEYSMLDGAAKLKPLFEEAARLGMPAVAMTDHG
FT                   NMFGSYEFWQTSKESGVKPIIGIEAYVAPESRFHKQRVFWGTGKTGDEAAEGGKDVSGG
FT                   GRYLHLTMWARNAKGLRNLFRLSSLASFEGYYTKPRMDLELMAQYSEGIMVTTGCPSGG
FT                   VQTRLRLGQEREAIEYAGKLRDIFGRDSVFVELMDHGLDIEREVRSGLLTVAKKLGLRP
FT                   VVTNDSHYVTEDQAAAHDALLAVGVGKNLDDPTRFRFNGTGYYLKSAEEMRSLNTFDEW
FT                   LEGCRNTLWIAEQVEDGAYDDVFRPRDLMPKFPVPEGETQASWLRKEIERCIPNRYPNG
FT                   PSREVRERIEHELSIIERMGFPAYFLVVADICQYARRSGIALGPGRGSATGSMVAYVLG
FT                   ITDLDPLEHSLLFERFLNPERVSMPDIDLDFDERKRGDMIRYVTERYGEDRVAQILTFG
FT                   TIKAKAAIKDATRILGYPYALGDKITKAFPPAVGGKEIPLSAVFDESHPRYNEAAELRQ
FT                   LIESNPDVRKVYETASGLEGLTRGTGVHAAGVILSAEPLLDVIPLHKRETDGAIITGFP
FT                   YPQCEEMGLLKMDFLGLRNLTVIDDAIQNIKANEGKEINLSALPLDNKKTYELLSRGDT
FT                   LGVFQLDGGPMRALLKRMEPKKFGDIAAVLALYRPGPMAANAHNDYADRSNGRQEITPI
FT                   HPELKEALDPILAESFHLIVYQEQVMAIAQQLAGYTLGGADLLRRAMGKKKKEALEKEY
FT                   TKFSEGMLSRGFSKEAMQALWDVMLPFSGYAFNKSHTAGYGMISYWTAYLKANHPASYM
FT                   AALLTSVADDKDKMAVYLAECRKMGIRVLPPDVNESGLQFTPVGNDIRFGLGAVRNVGA
FT                   NVVESILKTREEKGKFTSFVDFLSKIELTVCNKRVIESLIKAGAFDSLGHSRLDLYRHH
FT                   EAAVDAVLSSKKQEAHGQFDLFGGGDEEDGGESAPLGFSINWTGEEWDRKTKLAFEREM
FT                   LGLYVSSHPLAGAERILARASDAPLLDVVNGERRNNDEVRIAGLISKVEKRINKAGNQW
FT                   AIATVEDLDASIEALFFPKVYPLYVDALVEDTAVSIKGRLNDRDGTFSLFVSEMSILDI
FT                   SHVSEGEPPVLLTIPEKRVTRELISELKQTLRSHRGDTPVRIRVDNPRRSRIFAIDDYP
FT                   VRVSPEFSGEVKSLLGPESITY"
     gtgacgaacg atcccttcgt ccaccttcac gtccacaccg agtattcgat gctggacggt        60
     gccgccaagc tcaagccgct gttcgaggaa gctgcccggt tgggcatgcc tgccgtggcg       120
     atgacggacc acggaaacat gttcgggtct tacgagttct ggcagacctc caaggagtcg       180
     ggggtcaagc cgatcatcgg gatcgaggcg tatgtggcgc ccgagtcccg cttccacaag       240
     cagcgtgtgt tctgggggac gggaaagacc ggcgacgagg ctgctgaggg tggcaaggac       300
     gtttctggcg gcggccgcta cctgcacttg accatgtggg cgcggaacgc gaaagggctg       360
     cgcaacctgt tccggttgtc gtcgctcgcg tctttcgagg gctactacac caaaccgcgc       420
     atggacttgg agctgatggc ccagtacagc gagggcatca tggtcaccac cgggtgcccg       480
     tcgggtgggg tgcagacccg gctgcggctc ggccaggagc gggaggctat cgaatacgcg       540
     ggcaagctcc gggatatttt cggtcgcgac tccgtgttcg tggagttgat ggaccacggt       600
     ctggatattg agcgggaagt ccgctccggc ttgttgactg tggcgaagaa gctcggcctg       660
     cggcccgtgg tcaccaacga ctcccactat gtgaccgagg accaggcggc cgcgcatgac       720
     gcgctgctgg ccgtgggtgt gggcaagaac ctcgacgacc ctacgcgttt ccggttcaac       780
     ggcaccggct actacctcaa aagcgcagaa gagatgcggt ccctcaacac gttcgacgaa       840
     tggttggagg ggtgccgcaa cacgctgtgg atcgccgagc aggtggagga cggcgcatac       900
     gacgacgtgt tccgcccccg ggacttgatg ccgaagttcc cggtgccgga aggggagacg       960
     caggcgagct ggctgcgcaa ggagattgaa cgctgcatcc cgaaccggta ccccaacggg      1020
     ccgagccggg aagtgcggga acgtatcgaa cacgagttga gcatcatcga gcggatgggg      1080
     ttccccgcct acttcctggt ggtggcggac atctgccagt acgcgcggcg ttcggggatc      1140
     gcgctggggc cggggcgtgg ttcggcgacc gggtcgatgg tggcctacgt gctcgggatc      1200
     accgacttgg acccgttgga gcactcgctg ctgtttgaac ggttcctcaa ccccgagcgt      1260
     gtgtcgatgc ctgacatcga cttggacttc gacgaacgta agcgcggcga catgatccgc      1320
     tacgtgacgg aacgctacgg ggaggaccgg gtcgcgcaga tcctcacgtt cggcacgatt      1380
     aaggcgaagg ctgcgatcaa ggacgcgacg cggatcctcg gctacccgta cgcgctcggt      1440
     gacaagatca cgaaggcgtt cccgccggcg gtgggtggta aagagattcc gctgtccgcg      1500
     gtcttcgacg aaagccaccc ccgctacaac gaggcggctg agctgcggca gctcatcgaa      1560
     tccaacccgg acgtccgcaa ggtgtatgag actgcaagcg gtctggaagg gctgacccgg      1620
     ggcacgggtg tgcacgcggc gggtgtgatc ctctccgctg agccgctgct cgatgtgatc      1680
     ccgctgcaca agcgggagac ggacggggcc atcatcacag gcttccccta tccccagtgc      1740
     gaggagatgg gcctgttgaa gatggacttc ctggggttgc ggaacctgac ggtcatcgac      1800
     gacgcgatcc agaacatcaa ggccaacgag ggcaaggaga tcaacctgtc cgccctgccg      1860
     ttggacaaca agaagacgta tgagctgctg tcgcgcgggg acacgctcgg cgtgttccag      1920
     ctcgacggtg gtccgatgcg ggcgctgctc aagcggatgg agccgaagaa gttcggtgac      1980
     attgccgctg tgctcgccct gtaccggcct ggtccgatgg cggcgaacgc gcacaacgac      2040
     tatgcggacc ggtcgaacgg gcgccaggag atcactccga tccacccgga gctgaaggag      2100
     gcgttggacc cgatcctcgc cgagtctttc cacctgatcg tctaccagga gcaggtgatg      2160
     gcgatcgccc agcagctcgc cgggtacacg ctgggcggcg cggacttgtt gcgccgcgcg      2220
     atggggaaga agaagaagga ggccctggag aaggagtaca ccaagttctc cgaaggcatg      2280
     ctgtcccggg gcttctccaa ggaggccatg caggccttgt gggacgtgat gcttcccttc      2340
     tccggctacg cgttcaacaa gtcgcacacg gccgggtacg ggatgatttc ttattggacc      2400
     gcctatttga aggcgaatca cccggcgtcc tacatggcgg ctctgctcac gtcggtggcg      2460
     gacgacaagg acaagatggc tgtctatctg gcggagtgcc ggaagatggg catccgggtg      2520
     ctgccgccgg acgtcaacga gtcgggtctg cagttcaccc cggtcggcaa cgacatccgt      2580
     ttcgggttgg gcgcggtccg caacgtgggc gccaacgtgg tggagtcgat cctcaagacc      2640
     cgtgaggaga aggggaagtt cacgtcgttt gtagacttcc tgtcgaagat tgagctgacg      2700
     gtctgcaaca agcgggtcat cgagtcgctg atcaaggcgg gggcgttcga ctcgctcggc      2760
     cactctcgcc tggacttgta ccggcaccac gaggccgcgg tggatgcggt gctcagttcg      2820
     aagaagcagg aggcgcacgg ccagttcgac ctgttcggcg ggggtgacga ggaggacggc      2880
     ggggagagcg cgccgctggg cttctccatc aactggacgg gtgaggagtg ggaccggaag      2940
     accaagctcg cgtttgagcg ggagatgctc ggcttgtacg tgtccagcca tcctttggcg      3000
     ggggccgagc ggattctggc gcgggctagt gacgccccgc tgctggacgt ggtgaacggg      3060
     gagcgccgca acaacgacga ggtgcggatt gcgggcttga tctccaaggt ggagaagcgc      3120
     atcaacaagg cgggcaacca gtgggcgatc gccacggtcg aggatttgga cgcttctatt      3180
     gaggctttgt tcttccccaa ggtgtatccg ctgtatgtgg acgctttggt ggaggacacc      3240
     gcggtgtcga tcaaggggcg gctcaacgac cgggacggca ccttctccct cttcgtgtcc      3300
     gagatgtcga ttttggacat ttcccatgtg tctgaggggg agccgccggt tctgttgact      3360
     attccggaga agagggtcac ccgggagttg atcagcgagc tgaagcagac gctgcgcagc      3420
     caccgggggg acacgccggt gcggatccgg gtggacaacc cgcggcggtc gcggattttc      3480
     gcgatcgacg actatccggt gcgggtcagc ccggagtttt cgggtgaggt gaagagcctg      3540
     ctgggaccgg agtcgatcac ctactga                                          3567
//

If you have problems or comments...

PBIL Back to PBIL home page