(data stored in ACNUC7421 zone)

EMBL: CP000088.PE450

CP000088.PE450       Location/Qualifiers
FT   CDS_pept        511624..512421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54490"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54490.1"
FT                   /translation="MTGAWRSLVNPPLCSLSDEMQETTEWFTGDTVIPFARLVRAGSGG
FT                   QGKEERVRATRAAAFPLAASILAAPACGFGTPSQVMPGLAHPMASSESGFQVSDEATLH
FT                   NYTGINVVLPDGWHTDIADNCLSPPEVGPAPGGNCPSEALRIRINASEEGLIDPEGAEL
FT                   TDPDSWRRPWASCPKRPELNARIRAEHSEIVEHGDFLLVSGEETKYSEWLITCTGGGTF
FT                   RTRAWYVPEADLEFDVPVMVEERAEEYDLIVRSADLSRFKAIS"
     atgacgggtg cgtggcggag tctcgtcaac ccgccactgt gctccctatc tgatgagatg        60
     caggaaacca cggaatggtt tacgggggat accgtgattc cgttcgcccg cctggtgaga       120
     gcgggaagcg gcgggcaagg aaaggaggag cgtgtgcggg caaccagggc tgcggcgttc       180
     ccgctggccg cgtcgatatt ggcggctccg gcatgcggtt tcggcacgcc ctcgcaggtg       240
     atgcctgggc tcgcgcatcc gatggcttcg tccgaatcag gtttccaggt gtccgacgag       300
     gccacgttgc acaactacac cgggatcaac gtagtgctgc cggacggctg gcacacggat       360
     atcgccgaca actgcctttc gccgccggaa gtggggcccg ccccgggcgg caactgcccg       420
     agcgaggcgt tgcgcatccg gatcaacgcg tctgaagagg ggctgatcga cccggagggc       480
     gcggagttga cggacccgga cagttggcgg cggccgtggg cgtcgtgccc gaagcgcccc       540
     gagctcaatg cacggattcg ggccgagcac tccgagatcg ttgagcacgg cgatttcctg       600
     ctggtcagcg gggaagagac gaagtacagc gagtggctga tcacgtgcac gggcgggggg       660
     acattccgca ctcgcgcctg gtatgtcccc gaagcggact tggaattcga tgtgccggtc       720
     atggtggagg agcgcgccga agagtatgac ctgattgtcc gctcagcgga tctgtcccgc       780
     ttcaaagcga tctcctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page