(data stored in ACNUC7421 zone)

EMBL: CP000088.PE451

CP000088.PE451       Location/Qualifiers
FT   CDS_pept        512808..513197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54491"
FT                   /db_xref="GOA:Q47SS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54491.1"
FT                   /translation="MQSFFWVIPALVLAVAVFYSVVAVAIRDEETERTLFDPVFPVSFR
FT                   GLVRGLVNFRVANPPATVHGALRRLREQQGRDIAEPGLDSDVSIAGADHAVTAVSRSAP
FT                   QLRRDDAPAAREDAGPAPETRCSAR"
     atgcagtcgt ttttctgggt gatccccgcc ctcgttctgg ctgtagccgt cttctactcc        60
     gttgtcgctg tcgcgatccg cgacgaggag acggaacgga ccctgttcga cccggttttc       120
     ccggtctctt ttcgcggcct ggtcaggggc ctggtcaatt tccgagtcgc gaatccaccg       180
     gccacagtcc acggtgcgct ccgccggctg cgggaacagc agggccggga tatcgctgag       240
     ccgggcctgg acagcgacgt cagcattgcc ggtgcggacc acgccgtcac ggcggtgagc       300
     cgttccgcac cgcaactgcg cagagacgac gctcccgcgg cccgggaaga cgcgggaccg       360
     gcccccgaga ctcgctgctc tgcccggtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page