(data stored in ACNUC7421 zone)

EMBL: CP000088.PE456

CP000088.PE456       Location/Qualifiers
FT   CDS_pept        519232..519882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0458"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54496"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54496.1"
FT                   /translation="MRPLKGQSLLKNRISLRLATAAGTAALTVAGATFGFSAFAADTGA
FT                   APDQAASAAILPDEADTESFFPDDSQGVPAGQLEQASTEREQALAQSLATASGTLEEEK
FT                   EEEEEPEPVSIPSGDPRAIAQAMLADYGWGSDQFSCLDSLWQRESNWNPQARNPYSGAY
FT                   GIPQALPGEKMASAGSDWQTNPATQIKWGLGYIKDRYGSPCAAWEHSQSVGWY"
     atgcgaccgt tgaaaggcca atccttgctg aagaaccgaa tttcgttgcg gctcgctacc        60
     gcggctggaa cggcggcgct cactgtcgcc ggtgcaacgt tcggcttctc cgctttcgcc       120
     gccgataccg gcgccgcgcc ggaccaggct gcctcagccg caatcctgcc cgacgaagcg       180
     gacacagagt ccttcttccc cgacgactcc cagggagtcc cggcgggtca gctcgaacag       240
     gccagcactg agcgggagca ggctcttgcg cagtccctcg ccaccgccag cggcaccctg       300
     gaagaggaaa aggaagaaga ggaagaaccg gaacccgtat ccatccccag cggcgaccct       360
     cgggcgatcg cccaggccat gctcgccgac tacggctggg gatccgacca gttcagttgc       420
     ctcgactccc tgtggcagcg ggagagcaac tggaaccccc aggcccgcaa cccctactcc       480
     ggcgcctacg gcatcccgca ggcgctgccc ggcgagaaaa tggccagcgc cggatccgac       540
     tggcagacca accccgccac ccagatcaag tggggactgg gctacatcaa ggaccgctac       600
     ggcagcccgt gtgcggcctg ggagcactcg cagagcgtcg gctggtacta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page