(data stored in ACNUC7421 zone)

EMBL: CP000088.PE458

CP000088.PE458       Location/Qualifiers
FT   CDS_pept        complement(521818..522414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54498"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54498.1"
FT                   /translation="MTGVMEGTSPERLRASDADRERVLAVLREAVADGRLDFEEFQERS
FT                   DRAAAARRLGDLVGLTTDLVPPEAQPLRLDSGPVAALFGAKRRGGRWVVPSQQWVFSLF
FT                   GSAELDLRDALLARDRVAVAASAFFGRVVIRVPEGMEVRIRRRSLFGRRAAVHPSPLRH
FT                   APVLEVDGVSLFGSVRVSTSRKRRLGRGRPRRELR"
     ttgacgggtg tgatggaggg aacttccccg gaacggctgc gggcatccga cgcggaccgg        60
     gagcgtgtac tggcggtgct ccgcgaggca gtggcggacg gccgtttgga cttcgaagaa       120
     ttccaggagc gcagcgaccg ggctgccgca gcacgccgcc tcggcgacct ggtggggctc       180
     accaccgacc tggtgccgcc ggaggcgcag ccgctgcggt tggactccgg gccggtggcc       240
     gcgctgttcg gtgcgaagcg gcggggcgga cgctgggtgg tccccagcca gcagtgggtg       300
     ttctccctgt tcggtagtgc cgagctggac ttgcgggacg cgctgctcgc ccgggaccgg       360
     gtggcggtgg ccgcttccgc gttcttcggc cgcgtggtga tccgcgtgcc ggaaggcatg       420
     gaggtgcgga tccggcgccg ctccttgttc ggtaggcggg ccgcagtcca cccctcgccg       480
     ctgcgtcacg cccccgtgct ggaggttgac ggggtcagcc tgttcggttc ggtgcgggtc       540
     agcacgtccc ggaagcggcg gctggggcgt ggccggccgc ggcgtgaact gaggtga          597
//

If you have problems or comments...

PBIL Back to PBIL home page