(data stored in ACNUC7421 zone)

EMBL: CP000088.PE46

CP000088.PE46        Location/Qualifiers
FT   CDS_pept        complement(53074..53409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54086"
FT                   /db_xref="InterPro:IPR025591"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54086.1"
FT                   /translation="MEQALALGRREEVKVVVSNPCFELWLLYHFQELTSGVHRTVLLKE
FT                   KLPKYLSGYNKRLPVNFPYAAHPKAKARALRAAPKHTETCHKGPNPSTTVWLLIDAIRN
FT                   AGDAKRR"
     ttggagcagg cgttagccct cggcagacgc gaagaggtca aggtcgtcgt ctccaacccc        60
     tgtttcgagt tgtggctgct ctaccacttc caagagctga ccagtggggt gcaccgcacc       120
     gtgctcctca aggagaaact gccgaagtac ctctccgggt acaacaaacg ccttccggtg       180
     aactttccct acgcagccca tcccaaggcg aaagcccggg cgttgcgtgc cgctcccaaa       240
     cacacggaga cctgtcacaa gggaccgaac ccctccacca cggtgtggct gctcatcgac       300
     gcgatccgca acgccgggga cgcgaagcgg cgctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page