(data stored in ACNUC7421 zone)

EMBL: CP000088.PE461

CP000088.PE461       Location/Qualifiers
FT   CDS_pept        complement(524336..526009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54501"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54501.1"
FT                   /translation="MPPGHPAGPPPSHGQPQGPPPGQPQGAPPGQPQGAPPGQPQGVPS
FT                   GQPQGAPSGAALAAPHGPGGPGFPPSGQPMHSGPGGPPPRKKPVWLIPLSIVLAVALIG
FT                   GGVWASVALVNNLFGGAQPESVLPRSSAVFAKLDLKPTGQQWASYAQFYERLPDTLKDE
FT                   FESAEDDFGEELFEELFPNVELDYASEVEPWLGQRFGVAVWAGNEEPLYAIALAVEDEE
FT                   LAEETLTRIQSEDDTLFFEVVDGFAILTDSQDALNDRRFLVENEGTLEDNEDFADDISD
FT                   IGRGIATAWIDYGAIVHNEVLAADADLEDLAELGQVTGRLVAVVRMESKYLEFQANLVN
FT                   AALDGNTIFAESVPTGGITALHDLPDNSVIALGGDGLDAVAQAFWEANQGSIESSEDYE
FT                   EFDSAMRELGVRLPADFHKLLGTKTAFGMTDLEGLDYFGYSDIPFELRLTGADSALWDE
FT                   LVSPMSTGFGPSPSVTTDGDTTVISMGSAGTGRLGDDPVFQETMSGLEKAHLALYMDLR
FT                   AAAEMWEDARPNQWGGLGGALQFQENGSATLNLRWVPSPE"
     atgcctcccg gacaccctgc cggcccgcca ccgtcccacg gacagcccca ggggccaccc        60
     ccggggcagc cccagggggc tccgcctgga cagcctcagg gagcaccccc gggacagccc       120
     cagggcgtac cgtctgggca gccgcaggga gcaccctctg gggcggcgct agcggccccg       180
     cacggtccgg gcggtccggg ttttccgccc tcggggcagc cgatgcacag cggcccgggc       240
     ggcccgccgc cccgcaagaa gccggtctgg ctcattccgc tgtcgatcgt gctggccgtg       300
     gccctgatcg gcggtggggt gtgggcgtcc gtggccctgg tgaacaacct gttcggcggg       360
     gcgcagcccg agtcggtcct cccccgctcc tcggcagtgt tcgccaagct cgacctgaag       420
     cccacgggcc agcagtgggc gtcctacgcc cagttctacg aacggctccc tgacacgctg       480
     aaagacgagt tcgaaagcgc cgaagacgac ttcggtgagg agctgttcga agagctgttc       540
     cccaacgtcg agctcgacta cgcgtccgag gtcgaaccgt ggctggggca gcgtttcggt       600
     gttgccgtct gggcaggcaa cgaggagccc ctgtacgcga tcgccctcgc cgtggaggac       660
     gaggagctcg cagaggagac cctgacccgg atccagagcg aggacgacac gctcttcttc       720
     gaagtcgtcg acgggttcgc gatcctcacc gactcccagg acgcgctcaa cgaccggcgc       780
     ttcctcgtcg agaacgaagg cacgctggag gacaacgagg acttcgccga cgacatctcc       840
     gacatcggcc ggggaatcgc cacggcgtgg atcgactacg gcgcgatcgt ccacaacgag       900
     gtgcttgccg cagacgccga cctggaagac ctggctgagc tcggccaagt caccggccgg       960
     ctcgtcgcgg tcgtgcggat ggagagcaag tacctggaat tccaggccaa cctggtcaac      1020
     gcggcgcttg acggcaacac tatcttcgcc gagtcggtgc ctaccggggg catcaccgcg      1080
     ctgcacgacc tgcccgacaa ctcggtgatc gcgctcggcg gggacgggct ggacgctgtc      1140
     gcccaggctt tctgggaagc caaccagggg agcatcgaat cgtccgagga ctacgaggag      1200
     ttcgacagcg cgatgcggga gctgggcgtg cgcctgcccg ctgacttcca caagcttctg      1260
     ggcaccaaga cggccttcgg catgaccgac ttggagggcc tagactactt cgggtacagc      1320
     gacatcccct tcgaactgcg gctgacaggc gcagacagcg ctctgtggga cgagctggtc      1380
     tcccccatga gcaccgggtt cggcccttcg ccttcggtga ccaccgacgg cgacaccacg      1440
     gtgatctcca tgggcagcgc cggaacgggg cggctcggtg acgacccggt cttccaggag      1500
     acgatgagcg ggttggagaa agcccacctg gcgctctaca tggacctgcg ggccgcagcc      1560
     gaaatgtggg aggacgcgcg tccgaaccag tggggtggcc tgggcggcgc cctgcagttc      1620
     caggagaacg gctcggcgac gctcaacctg cgctgggttc ccagccctga gtga            1674
//

If you have problems or comments...

PBIL Back to PBIL home page