(data stored in ACNUC7421 zone)

EMBL: CP000088.PE463

CP000088.PE463       Location/Qualifiers
FT   CDS_pept        527456..528058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54503"
FT                   /db_xref="GOA:Q47SR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54503.1"
FT                   /translation="MEKVEKPVRASARGAATRSALLEAASYVFRTSGFDKAGVSEVVAQ
FT                   AGASVGSLYHHFTGKADLYLALYQEFQQRQQERTHQAVVDARAEGENDPRKLMTIAARA
FT                   YLEGCIEERELTRIFYSGDSPPGFEALMRQQLREWTGRNAALFRKADEPVDEALLMIVT
FT                   GSISLAATEVIERDPDEARKLADAVVERLSSLTPRKE"
     gtggagaagg tggaaaagcc ggtgcgggcc tcggcccgag gagcggccac acgcagcgcg        60
     ctgttggaag cggcgtcgta cgtgttccgc acatccggtt tcgataaagc tggggtcagc       120
     gaggttgtcg cccaggccgg agctagcgtc gggagcctct accaccactt caccgggaag       180
     gcggacctct acctggcgct ctaccaggag ttccagcagc gccagcagga gcggacccac       240
     caggcggtgg tcgacgcccg ggcggaagga gagaacgacc cccgcaagct catgaccatc       300
     gctgcacgcg cctacctgga agggtgtatt gaggagcggg aactcacgcg gatcttctac       360
     agcggggaca gccctcccgg gttcgaagcg ctcatgcgcc agcagttgcg ggagtggacc       420
     ggccgtaacg ccgccctgtt ccgcaaggcg gacgaacccg tggacgaagc gctgctgatg       480
     atcgtcaccg gttcgatctc cctggccgcg accgaggtca tcgaacggga cccggacgag       540
     gcccggaaac tcgccgacgc cgtggtggaa cggctcagtt ctctgacacc ccggaaagag       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page