(data stored in ACNUC7421 zone)

EMBL: CP000088.PE464

CP000088.PE464       Location/Qualifiers
FT   CDS_pept        528121..528693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0466"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54504"
FT                   /db_xref="GOA:Q47SR3"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54504.1"
FT                   /translation="MSSGSRRSDNTFLGYAIVLGALIALVVLITVVVDSGRSEQIPTVD
FT                   YTPDALTLSEIAPYQAYAPDQDQLPEGWTPTSSRLNDGGALTEEEPTEPVRWSVGFATP
FT                   EDRHAAFHISDADPDAFIAEVTMRGEPDGESTINGQVWERRYNEVEDERSLVLRTDDAT
FT                   LIVSGGASYEELETLAGALEPQTPAQE"
     atgagcagcg gtagccgtcg gagcgacaac accttcctgg gctacgcgat cgtgctgggc        60
     gcactgatcg ccctggtcgt cctgatcacg gtggtggtgg actcgggacg gtcggagcag       120
     atccctaccg tcgactacac ccccgacgcg ttgaccctca gcgagatcgc gccctaccag       180
     gcgtacgcgc ctgaccagga ccaactgccc gaggggtgga cccccacgag ttcgcggctg       240
     aacgacggcg gcgcgctgac cgaagaggag ccgaccgaac cggtccgctg gtcggtgggg       300
     ttcgctaccc ccgaggaccg gcatgccgcg ttccacatca gcgacgctga cccggacgcg       360
     ttcatcgccg aagtcacgat gaggggcgaa cccgacgggg agtcgacgat caacggccaa       420
     gtctgggaac gccggtacaa cgaagtcgag gacgaacgct ccctcgtgct gcggaccgac       480
     gacgccacgc tcatcgtcag cgggggtgcc tcctacgagg aactggagac ccttgcgggg       540
     gcgctggaac cgcagacccc cgcacaggag tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page